BLASTX nr result
ID: Cimicifuga21_contig00019580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019580 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155123.1| PREDICTED: uncharacterized protein LOC101224... 64 1e-08 ref|XP_004152885.1| PREDICTED: uncharacterized protein LOC101202... 64 1e-08 gb|AAC39482.1| chloroplast processing enzyme [Arabidopsis thaliana] 64 1e-08 ref|XP_002516378.1| pitrilysin, putative [Ricinus communis] gi|2... 64 2e-08 ref|XP_003610819.1| Metalloendopeptidase [Medicago truncatula] g... 63 3e-08 >ref|XP_004155123.1| PREDICTED: uncharacterized protein LOC101224074 [Cucumis sativus] Length = 1267 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 42 QAKRTLLVRHEAESKSNAYWLGLLPHLQASSLQRKVNEIFYSFYSLYFGIMLGHCYV 212 +AKRTLL+RHEAE KSNAYWLGLL HLQASS+ RK SLY + Y+ Sbjct: 1153 RAKRTLLMRHEAEIKSNAYWLGLLAHLQASSVPRKDLSCIKDLTSLYEAATIDDVYI 1209 >ref|XP_004152885.1| PREDICTED: uncharacterized protein LOC101202810 [Cucumis sativus] Length = 1261 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 42 QAKRTLLVRHEAESKSNAYWLGLLPHLQASSLQRKVNEIFYSFYSLYFGIMLGHCYV 212 +AKRTLL+RHEAE KSNAYWLGLL HLQASS+ RK SLY + Y+ Sbjct: 1147 RAKRTLLMRHEAEIKSNAYWLGLLAHLQASSVPRKDLSCIKDLTSLYEAATIDDVYI 1203 >gb|AAC39482.1| chloroplast processing enzyme [Arabidopsis thaliana] Length = 1265 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 42 QAKRTLLVRHEAESKSNAYWLGLLPHLQASSLQRKVNEIFYSFYSLYFGIMLGHCYV 212 +AKRTLL+RHEAE KSNAYWL LL HLQASS+QRK SLY + Y+ Sbjct: 1151 RAKRTLLMRHEAELKSNAYWLNLLAHLQASSVQRKELSCIKELVSLYEAASIEDIYL 1207 >ref|XP_002516378.1| pitrilysin, putative [Ricinus communis] gi|223544476|gb|EEF45995.1| pitrilysin, putative [Ricinus communis] Length = 1268 Score = 63.5 bits (153), Expect = 2e-08 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 42 QAKRTLLVRHEAESKSNAYWLGLLPHLQASSLQRKVNEIFYSFYSLYFGIMLGHCYV 212 +AKRTLL+RHEAE KSNAYWLGLL HLQASS+ RK SLY + Y+ Sbjct: 1154 RAKRTLLMRHEAEVKSNAYWLGLLAHLQASSVPRKDISCIKDLTSLYEAATIDDIYL 1210 >ref|XP_003610819.1| Metalloendopeptidase [Medicago truncatula] gi|355512154|gb|AES93777.1| Metalloendopeptidase [Medicago truncatula] Length = 1299 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 42 QAKRTLLVRHEAESKSNAYWLGLLPHLQASSLQRKVNEIFYSFYSLY 182 +AKRTLL+RHEAE KSNAYWLGLL HLQASS+ RK SLY Sbjct: 1185 RAKRTLLMRHEAEIKSNAYWLGLLAHLQASSVPRKDISCIKDLTSLY 1231