BLASTX nr result
ID: Cimicifuga21_contig00019532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019532 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69846.1| hypothetical protein VITISV_038349 [Vitis vinifera] 57 1e-06 >emb|CAN69846.1| hypothetical protein VITISV_038349 [Vitis vinifera] Length = 414 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 2/91 (2%) Frame = +2 Query: 2 GLLQGK-NFMDVKIHACKGGWFLMSQSNNPTNHLFLYSLFANGGVIELPRLNST-FQIAT 175 G+++G+ NF+D + A + GW L S+ + LF + VI LP L S F++AT Sbjct: 151 GMMEGRSNFVDAEACASRDGWVLFSKEEGKGSLLFFFFSPFTKAVISLPHLESPGFEVAT 210 Query: 176 FSTTPTDSDCVFFAMYSESKSTSVRVSTCCP 268 FS+ PT DCV F + +S + +S C P Sbjct: 211 FSSAPTFPDCVVFVTH-PPESGKISISICRP 240