BLASTX nr result
ID: Cimicifuga21_contig00019232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019232 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836076.1| ATP synthase CF0 subunit I [Megaleranthis sa... 223 2e-56 gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] 218 4e-55 ref|YP_001004172.1| ATP synthase CF0 subunit I [Ranunculus macra... 218 4e-55 ref|YP_001294170.1| ATP synthase CF0 subunit I [Buxus microphyll... 218 5e-55 ref|YP_740551.1| ATP synthase CF0 subunit I [Platanus occidental... 216 1e-54 >ref|YP_002836076.1| ATP synthase CF0 subunit I [Megaleranthis saniculifolia] gi|226933868|gb|ACO92001.1| ATP synthase CF0 subunit I [Megaleranthis saniculifolia] Length = 184 Score = 223 bits (567), Expect = 2e-56 Identities = 114/118 (96%), Positives = 116/118 (98%) Frame = +2 Query: 2 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKATARLRKVKMEADEFRVNGYSEIEREKL 181 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKA ARLRKV+MEADEFRVNGYSEIEREK Sbjct: 49 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKAKARLRKVQMEADEFRVNGYSEIEREKF 108 Query: 182 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 355 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQAL+GALGTLNSCLNNELHL Sbjct: 109 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALEGALGTLNSCLNNELHL 166 >gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] Length = 188 Score = 218 bits (555), Expect = 4e-55 Identities = 112/118 (94%), Positives = 113/118 (95%) Frame = +2 Query: 2 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKATARLRKVKMEADEFRVNGYSEIEREKL 181 LSDLLDNRKQRILSTIRNSEELR GAIEKLEKA ARLRKVK EADEFR NGYSEIEREK Sbjct: 54 LSDLLDNRKQRILSTIRNSEELRGGAIEKLEKAKARLRKVKAEADEFRTNGYSEIEREKC 113 Query: 182 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 355 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQR+FQQALQGALGTLNSCLNNELHL Sbjct: 114 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRIFQQALQGALGTLNSCLNNELHL 171 >ref|YP_001004172.1| ATP synthase CF0 subunit I [Ranunculus macranthus] gi|226694449|sp|A1XGM4.1|ATPF_RANMC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|85540790|gb|ABC70742.1| ATP synthase CF0 subunit I [Ranunculus macranthus] Length = 183 Score = 218 bits (555), Expect = 4e-55 Identities = 112/118 (94%), Positives = 113/118 (95%) Frame = +2 Query: 2 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKATARLRKVKMEADEFRVNGYSEIEREKL 181 LSDLLDNRKQRILSTIRNSEELR GAIEKLEKA ARLRKVK EADEFR NGYSEIEREK Sbjct: 49 LSDLLDNRKQRILSTIRNSEELRGGAIEKLEKAKARLRKVKAEADEFRTNGYSEIEREKC 108 Query: 182 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 355 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQR+FQQALQGALGTLNSCLNNELHL Sbjct: 109 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRIFQQALQGALGTLNSCLNNELHL 166 >ref|YP_001294170.1| ATP synthase CF0 subunit I [Buxus microphylla] gi|226741352|sp|A6MM22.1|ATPF_BUXMI RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|146762271|gb|ABQ45235.1| ATP synthase CF0 subunit I [Buxus microphylla] Length = 184 Score = 218 bits (554), Expect = 5e-55 Identities = 112/118 (94%), Positives = 115/118 (97%) Frame = +2 Query: 2 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKATARLRKVKMEADEFRVNGYSEIEREKL 181 LSDLLDNRKQRILSTIRNSEELR GAIE+LEKA ARLRKV+MEADEFRVNGYSEIEREKL Sbjct: 49 LSDLLDNRKQRILSTIRNSEELRVGAIEQLEKARARLRKVEMEADEFRVNGYSEIEREKL 108 Query: 182 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 355 NLINSTY+NLERLENYKNETI FEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL Sbjct: 109 NLINSTYKNLERLENYKNETIHFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 166 >ref|YP_740551.1| ATP synthase CF0 subunit I [Platanus occidentalis] gi|122166049|sp|Q09G60.1|ATPF_PLAOC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|114054370|gb|ABI49764.1| ATP synthase CF0 subunit I [Platanus occidentalis] Length = 184 Score = 216 bits (551), Expect = 1e-54 Identities = 112/118 (94%), Positives = 115/118 (97%) Frame = +2 Query: 2 LSDLLDNRKQRILSTIRNSEELREGAIEKLEKATARLRKVKMEADEFRVNGYSEIEREKL 181 LSDLLDNRKQRILSTIRNSEELR GAIE+LEKA ARLRKV+MEADEFRVNGYSEIEREKL Sbjct: 49 LSDLLDNRKQRILSTIRNSEELRGGAIEQLEKARARLRKVEMEADEFRVNGYSEIEREKL 108 Query: 182 NLINSTYQNLERLENYKNETIQFEQQRAINQVRQRVFQQALQGALGTLNSCLNNELHL 355 NLINSTY+NLERLENYKNETIQFEQQRAINQVRQRVFQQALQ ALGTLNSCLNNELHL Sbjct: 109 NLINSTYKNLERLENYKNETIQFEQQRAINQVRQRVFQQALQRALGTLNSCLNNELHL 166