BLASTX nr result
ID: Cimicifuga21_contig00019095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019095 (845 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase ac... 92 1e-16 ref|XP_002303243.1| predicted protein [Populus trichocarpa] gi|2... 91 2e-16 ref|XP_002298092.1| predicted protein [Populus trichocarpa] gi|2... 91 3e-16 ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus ... 90 7e-16 ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase ac... 89 1e-15 >ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 92.0 bits (227), Expect = 1e-16 Identities = 36/68 (52%), Positives = 51/68 (75%) Frame = +3 Query: 39 DDEAVEGANGGIPEGQLCVVCLSRRRTFVFVPCGHMVCCRRCARSVQRGFIPKCPLCRRA 218 D + E G +P+G+LCV+CL RR+ FVPCGH+VCC+RCA SV+R PKCP+CR+ Sbjct: 322 DTQIAEDDAGDVPDGELCVICLMRRKRSAFVPCGHLVCCQRCALSVERELSPKCPVCRQI 381 Query: 219 IETSVKLF 242 I +SV+++ Sbjct: 382 IRSSVRIY 389 >ref|XP_002303243.1| predicted protein [Populus trichocarpa] gi|222840675|gb|EEE78222.1| predicted protein [Populus trichocarpa] Length = 391 Score = 91.3 bits (225), Expect = 2e-16 Identities = 38/77 (49%), Positives = 53/77 (68%) Frame = +3 Query: 12 SRDNVANVHDDEAVEGANGGIPEGQLCVVCLSRRRTFVFVPCGHMVCCRRCARSVQRGFI 191 S ++V+ + D+E G +PEGQLCV+CL RRR F+PCGH+ CC CA SV+ Sbjct: 317 SDEDVSQIDDNEDA----GDVPEGQLCVICLMRRRRAAFIPCGHLACCHTCAVSVESEVS 372 Query: 192 PKCPLCRRAIETSVKLF 242 PKCPLCR+A+ S+++F Sbjct: 373 PKCPLCRQAVRNSIRIF 389 >ref|XP_002298092.1| predicted protein [Populus trichocarpa] gi|222845350|gb|EEE82897.1| predicted protein [Populus trichocarpa] Length = 390 Score = 90.9 bits (224), Expect = 3e-16 Identities = 38/74 (51%), Positives = 53/74 (71%) Frame = +3 Query: 21 NVANVHDDEAVEGANGGIPEGQLCVVCLSRRRTFVFVPCGHMVCCRRCARSVQRGFIPKC 200 +V+ + +DEA G +P+GQLCV+CL+RRR F+PCGH+ CC CA SV+ PKC Sbjct: 320 DVSRIDEDEA-----GDVPDGQLCVICLTRRRRSAFIPCGHLACCHFCAISVESEVSPKC 374 Query: 201 PLCRRAIETSVKLF 242 PLCR+AI S+++F Sbjct: 375 PLCRQAIRNSIRVF 388 >ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 387 Score = 89.7 bits (221), Expect = 7e-16 Identities = 36/64 (56%), Positives = 48/64 (75%) Frame = +3 Query: 51 VEGANGGIPEGQLCVVCLSRRRTFVFVPCGHMVCCRRCARSVQRGFIPKCPLCRRAIETS 230 VE +P+GQLCV+CL RRR F+PCGH+VCC+ CA SV+R PKCPLCR+A+ S Sbjct: 322 VEEETVDVPDGQLCVICLMRRRRAAFIPCGHLVCCQICAISVEREVSPKCPLCRQAVRNS 381 Query: 231 VKLF 242 +++F Sbjct: 382 IRIF 385 >ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] gi|449480528|ref|XP_004155921.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Length = 389 Score = 89.0 bits (219), Expect = 1e-15 Identities = 37/72 (51%), Positives = 53/72 (73%) Frame = +3 Query: 27 ANVHDDEAVEGANGGIPEGQLCVVCLSRRRTFVFVPCGHMVCCRRCARSVQRGFIPKCPL 206 ++V DDE + +P+GQLCV+CL RR+ F+PCGH+VCC RCA SV+R PKCP+ Sbjct: 320 SHVPDDEL----SSHVPDGQLCVICLMRRKRSAFIPCGHLVCCERCAVSVERESSPKCPI 375 Query: 207 CRRAIETSVKLF 242 CR+ I +SV+++ Sbjct: 376 CRQQIRSSVRIY 387