BLASTX nr result
ID: Cimicifuga21_contig00019057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00019057 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172890.1| PREDICTED: uncharacterized LOC101214322 [Cuc... 69 4e-10 ref|XP_004142839.1| PREDICTED: uncharacterized protein LOC101214... 69 4e-10 ref|XP_003616409.1| hypothetical protein MTR_5g079910 [Medicago ... 59 4e-07 ref|XP_002533152.1| transcription factor, putative [Ricinus comm... 59 4e-07 ref|XP_003544222.1| PREDICTED: uncharacterized protein LOC100811... 59 5e-07 >ref|XP_004172890.1| PREDICTED: uncharacterized LOC101214322 [Cucumis sativus] Length = 501 Score = 68.9 bits (167), Expect = 4e-10 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 6/100 (6%) Frame = +3 Query: 195 ADLYVETNKIFGRTSNDQSRK*RLICDKTCIEDPNRVSDELAKCLIGIFLKLNKP----- 359 +D+ + + R + +SR CIE PN +S++L KCLI I+L LN+P Sbjct: 134 SDIQITMSSTGARKNMTRSRNQSQFDKGPCIETPNEISEQLIKCLISIYLDLNQPSNNSQ 193 Query: 360 LSATVTKLGLSCINSKGIVGKTSSFNCKAP-MVLSDNYKT 476 S + K GLSCINSK + KT SF+CKAP + LS +Y + Sbjct: 194 TSPNIPKHGLSCINSKRSIAKT-SFSCKAPQLTLSFDYSS 232 >ref|XP_004142839.1| PREDICTED: uncharacterized protein LOC101214322 [Cucumis sativus] Length = 524 Score = 68.9 bits (167), Expect = 4e-10 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 6/100 (6%) Frame = +3 Query: 195 ADLYVETNKIFGRTSNDQSRK*RLICDKTCIEDPNRVSDELAKCLIGIFLKLNKP----- 359 +D+ + + R + +SR CIE PN +S++L KCLI I+L LN+P Sbjct: 153 SDIQITMSSTGARKNMTRSRNQSQFDKGPCIETPNEISEQLIKCLISIYLDLNQPSNNSQ 212 Query: 360 LSATVTKLGLSCINSKGIVGKTSSFNCKAP-MVLSDNYKT 476 S + K GLSCINSK + KT SF+CKAP + LS +Y + Sbjct: 213 TSPNIPKHGLSCINSKRSIAKT-SFSCKAPQLTLSFDYSS 251 >ref|XP_003616409.1| hypothetical protein MTR_5g079910 [Medicago truncatula] gi|355517744|gb|AES99367.1| hypothetical protein MTR_5g079910 [Medicago truncatula] Length = 526 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 6/79 (7%) Frame = +3 Query: 267 ICDKTCIEDPNRVSDELAKCLIGIFLKLN------KPLSATVTKLGLSCINSKGIVGKTS 428 I + +E+PN +S+EL KCLIGIFL+LN K +V++L LSC+ SK + T+ Sbjct: 169 ISRQNSVENPNELSEELLKCLIGIFLELNQASLDIKESETSVSRLTLSCMQSKSFISMTN 228 Query: 429 SFNCKAPMVLSDNYKTFID 485 S N K LS+ + +D Sbjct: 229 SSNYKTHSYLSNGNASCLD 247 >ref|XP_002533152.1| transcription factor, putative [Ricinus communis] gi|223527047|gb|EEF29233.1| transcription factor, putative [Ricinus communis] Length = 525 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 7/73 (9%) Frame = +3 Query: 288 EDPNRVSDELAKCLIGIFLKLN-------KPLSATVTKLGLSCINSKGIVGKTSSFNCKA 446 E PN +S+EL KCLIGIFL LN + +A V KL LSC++SK G SFNCKA Sbjct: 192 EKPNGLSEELIKCLIGIFLDLNQVPQNREESTAAIVPKLSLSCMHSK---GSKHSFNCKA 248 Query: 447 PMVLSDNYKTFID 485 M L N + +D Sbjct: 249 SMFLFTNNISNLD 261 >ref|XP_003544222.1| PREDICTED: uncharacterized protein LOC100811695 [Glycine max] Length = 521 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 5/60 (8%) Frame = +3 Query: 285 IEDPNRVSDELAKCLIGIFLKLNKPL-----SATVTKLGLSCINSKGIVGKTSSFNCKAP 449 IE PN +S+EL KCLIGIFL+LN+ S TV +L L C+ S G++ KT S NCK P Sbjct: 190 IEKPNELSEELLKCLIGIFLELNRASLDREESETVPRLTLPCMKSTGLMAKT-SLNCKEP 248