BLASTX nr result
ID: Cimicifuga21_contig00018953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018953 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514362.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002514362.1| conserved hypothetical protein [Ricinus communis] gi|223546818|gb|EEF48316.1| conserved hypothetical protein [Ricinus communis] Length = 809 Score = 57.0 bits (136), Expect = 2e-06 Identities = 38/76 (50%), Positives = 42/76 (55%), Gaps = 12/76 (15%) Frame = +2 Query: 125 TDARMSSSRASY-GGRNSWRREFSDRP---SGGR-DGFVSGDSHLRSVEDANYISRQVGG 289 T A SSR+ Y GGRN WRR FSDRP SGGR V+GDSH RSV++ N RQ G Sbjct: 13 TSASSMSSRSYYRGGRNQWRRGFSDRPQYSSGGRGPQLVTGDSHFRSVQETNSGIRQAAG 72 Query: 290 -------QHFPNSGGY 316 QH P Y Sbjct: 73 PQPYNQSQHRPQPPRY 88