BLASTX nr result
ID: Cimicifuga21_contig00018952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018952 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36186.3| unnamed protein product [Vitis vinifera] 57 2e-06 >emb|CBI36186.3| unnamed protein product [Vitis vinifera] Length = 899 Score = 56.6 bits (135), Expect = 2e-06 Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 7/78 (8%) Frame = +1 Query: 10 QSPDLIDPLHNYSELSLLPRTFEGFRSSENIKQ-------DDLQSVLEALAVNSSSNLSE 168 +S DL DPL Y LSL PRTF R S + + D L S L+++A+ S + L E Sbjct: 6 RSSDLADPLLGYFGLSLFPRTF---RDSSTVSKPSGHDNIDSLHSYLKSMALRSPTKLLE 62 Query: 169 QAKSVLNSSSELQNFEFP 222 QAKS+L+ SEL N FP Sbjct: 63 QAKSILDGGSELLNPNFP 80