BLASTX nr result
ID: Cimicifuga21_contig00018649
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018649 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN07997.1| contains similarity to reverse trancriptase , rel... 49 1e-06 ref|XP_002522452.1| nucleic acid binding protein, putative [Rici... 43 6e-06 >gb|ABN07997.1| contains similarity to reverse trancriptase , related [Medicago truncatula] Length = 407 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = -3 Query: 164 LQNGLPTRANL*MRNIITRPICPRCDNQVETVEHALFHCSEIRQIWYASKL 12 L + LP R++L R I P+CPRC ++ ET+ H C +++W+ S L Sbjct: 343 LNDSLPVRSSLRKRGIQCYPLCPRCHSKTETITHLFMSCPLSKRVWFGSNL 393 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 223 WKHLWKLDTAQRVKLFLWR 167 WK +W L T R K+ LWR Sbjct: 323 WKKIWSLHTIPRHKVLLWR 341 >ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis] gi|223538337|gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis] Length = 483 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = -3 Query: 167 ALQNGLPTRANL*MRNIITRPICPRCDNQVETVEHALFHCSEIRQIW 27 AL N LP R NL MR + CP C +Q ET+ H L C Q W Sbjct: 203 ALTNRLPVRTNLVMRKVTEDSSCPCCVSQPETIMHILVLCDVTTQSW 249 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -1 Query: 223 WKHLWKLDTAQRVKLFLWR 167 W+ LWKL+ A + K+F+WR Sbjct: 184 WRRLWKLNIAAKCKVFMWR 202