BLASTX nr result
ID: Cimicifuga21_contig00018551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018551 (196 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281400.2| PREDICTED: probable peptide transporter At1g... 61 8e-08 emb|CBI20867.3| unnamed protein product [Vitis vinifera] 61 8e-08 ref|XP_002281412.1| PREDICTED: probable peptide transporter At1g... 61 1e-07 ref|XP_003522705.1| PREDICTED: probable peptide transporter At1g... 60 2e-07 >ref|XP_002281400.2| PREDICTED: probable peptide transporter At1g52190-like [Vitis vinifera] Length = 583 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -2 Query: 195 KISWLATNPNKAHYDYEYALICLLCLLNFIYFLFCCGVRRPRKDGRARVSNERE 34 K SWL++N NK H DY Y LI +LCL+N IYFL CC P +D + +S+E E Sbjct: 519 KESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGPFEDEKPGISDEGE 572 >emb|CBI20867.3| unnamed protein product [Vitis vinifera] Length = 1181 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -2 Query: 195 KISWLATNPNKAHYDYEYALICLLCLLNFIYFLFCCGVRRPRKDGRARVSNERE 34 K SWL++N NK H DY Y LI +LCL+N IYFL CC P +D + +S+E E Sbjct: 525 KESWLSSNLNKGHLDYYYWLITILCLINIIYFLVCCWSYGPFEDEKPGISDEGE 578 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -2 Query: 195 KISWLATNPNKAHYDYEYALICLLCLLNFIYFLFCCGVRRPRKDGRARVSNERE 34 K SWL++N NK H DY Y LI +L ++NFIYFL CC + P +D + ++S E E Sbjct: 1116 KESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPCEDEKTKLSGEVE 1169 >ref|XP_002281412.1| PREDICTED: probable peptide transporter At1g52190 [Vitis vinifera] Length = 592 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -2 Query: 195 KISWLATNPNKAHYDYEYALICLLCLLNFIYFLFCCGVRRPRKDGRARVSNERE 34 K SWL++N NK H DY Y LI +L ++NFIYFL CC + P +D + ++S E E Sbjct: 527 KESWLSSNLNKGHLDYYYGLIAVLGMINFIYFLVCCRLYGPCEDEKTKLSGEVE 580 >ref|XP_003522705.1| PREDICTED: probable peptide transporter At1g52190-like [Glycine max] Length = 568 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -2 Query: 189 SWLATNPNKAHYDYEYALICLLCLLNFIYFLFCCGVRRPRKD 64 SWL++N NK HYDY Y LIC LC +NF+YFL+C P K+ Sbjct: 524 SWLSSNINKGHYDYYYTLICALCFVNFVYFLYCSKSYGPCKN 565