BLASTX nr result
ID: Cimicifuga21_contig00018431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018431 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containi... 85 5e-15 ref|XP_002531188.1| pentatricopeptide repeat-containing protein,... 80 2e-13 ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 emb|CAN82481.1| hypothetical protein VITISV_012747 [Vitis vinifera] 69 5e-10 ref|XP_003636527.1| Pentatricopeptide repeat-containing protein ... 65 6e-09 >ref|XP_003633738.1| PREDICTED: pentatricopeptide repeat-containing protein At1g66345, mitochondrial-like [Vitis vinifera] Length = 547 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = +1 Query: 1 RSLCHAGKLKEAEKYLQIMEDRSIVPNKCIYETLVHSHFQSGNMARALQLYNEMARRGLK 180 RSLC KL++AEKYL+IM+DRSI + C+YETL+ S+F+ G+ RA QL+NEM RGLK Sbjct: 479 RSLCQCRKLEKAEKYLRIMKDRSIAISTCVYETLISSYFEKGDELRASQLHNEMVSRGLK 538 Query: 181 PSC 189 PSC Sbjct: 539 PSC 541 >ref|XP_002531188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529229|gb|EEF31203.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 619 Score = 80.1 bits (196), Expect = 2e-13 Identities = 35/63 (55%), Positives = 47/63 (74%) Frame = +1 Query: 1 RSLCHAGKLKEAEKYLQIMEDRSIVPNKCIYETLVHSHFQSGNMARALQLYNEMARRGLK 180 RSLCH GKL++AEKYL+IM+ RS+ P++ +YE L+ H + + ARALQLYNEM +G Sbjct: 487 RSLCHCGKLEQAEKYLRIMKGRSLNPSQQVYEALIAGHLEKSDTARALQLYNEMISKGFT 546 Query: 181 PSC 189 P C Sbjct: 547 PCC 549 >ref|XP_002305195.1| predicted protein [Populus trichocarpa] gi|222848159|gb|EEE85706.1| predicted protein [Populus trichocarpa] Length = 556 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = +1 Query: 1 RSLCHAGKLKEAEKYLQIMEDRSIVPNKCIYETLVHSHFQSGNMARALQLYNEMARRGLK 180 + LC+ GKL+EAEKYL+IM RS+ P + +YE L+ +F+ G+ RAL LYNEM +GLK Sbjct: 486 KGLCNCGKLEEAEKYLRIMIGRSLNPREDVYEALIKVYFEKGDKRRALNLYNEMVSKGLK 545 Query: 181 PSC 189 C Sbjct: 546 LCC 548 >emb|CAN82481.1| hypothetical protein VITISV_012747 [Vitis vinifera] Length = 642 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = +1 Query: 1 RSLCHAGKLKEAEKYLQIMEDRSIVPNKCIYETLVHSHFQSGNMARALQLYNEM 162 RSLC KL++AEKYL+IM+DRSI + C+YETL+ +F+ G+ RA QL+NEM Sbjct: 479 RSLCQCRKLEKAEKYLRIMKDRSIAISTCVYETLISGYFEKGDELRASQLHNEM 532 >ref|XP_003636527.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502462|gb|AES83665.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 263 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/60 (55%), Positives = 40/60 (66%) Frame = +1 Query: 7 LCHAGKLKEAEKYLQIMEDRSIVPNKCIYETLVHSHFQSGNMARALQLYNEMARRGLKPS 186 LC GK+ +AEK L+IM+ RS+ PN IYETL+ H Q GN RA QL NEMA L+ S Sbjct: 204 LCRCGKVDDAEKCLRIMKGRSLAPNVGIYETLITCHVQKGNSVRAFQLRNEMASLELQRS 263