BLASTX nr result
ID: Cimicifuga21_contig00018364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018364 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269066.2| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 emb|CBI17752.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002304774.1| predicted protein [Populus trichocarpa] gi|2... 65 6e-09 ref|XP_002513116.1| pentatricopeptide repeat-containing protein,... 65 8e-09 ref|XP_003598903.1| Pentatricopeptide repeat-containing protein ... 64 1e-08 >ref|XP_002269066.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Vitis vinifera] Length = 1294 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 293 YDELLIEHMKKKSAGLVLSGLKFFGLESKLKSKGSTLL 180 YDE+LIEHMKKK+A LVLSGLKFFGLESKL+SKGSTLL Sbjct: 1186 YDEILIEHMKKKTADLVLSGLKFFGLESKLRSKGSTLL 1223 >emb|CBI17752.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 293 YDELLIEHMKKKSAGLVLSGLKFFGLESKLKSKGSTLL 180 YDE+LIEHMKKK+A LVLSGLKFFGLESKL+SKGSTLL Sbjct: 682 YDEILIEHMKKKTADLVLSGLKFFGLESKLRSKGSTLL 719 >ref|XP_002304774.1| predicted protein [Populus trichocarpa] gi|222842206|gb|EEE79753.1| predicted protein [Populus trichocarpa] Length = 728 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 293 YDELLIEHMKKKSAGLVLSGLKFFGLESKLKSKGSTLL 180 +DE+LIEHMKKK+A LVL+GLKFFGLESKLK+ GSTLL Sbjct: 689 FDEILIEHMKKKTADLVLAGLKFFGLESKLKAMGSTLL 726 >ref|XP_002513116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548127|gb|EEF49619.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1128 Score = 64.7 bits (156), Expect = 8e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 293 YDELLIEHMKKKSAGLVLSGLKFFGLESKLKSKGSTLLT 177 YDE LIEHMKKK+A LV+SGLKFFGLESKL++KG TLL+ Sbjct: 1089 YDERLIEHMKKKTADLVVSGLKFFGLESKLRAKGCTLLS 1127 >ref|XP_003598903.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355487951|gb|AES69154.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 767 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 293 YDELLIEHMKKKSAGLVLSGLKFFGLESKLKSKGSTL 183 YDELLI+HMKKK+A LV+SGLKFFGLESKLKSKG L Sbjct: 684 YDELLIDHMKKKTADLVISGLKFFGLESKLKSKGCKL 720