BLASTX nr result
ID: Cimicifuga21_contig00018344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018344 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542589.1| PREDICTED: WUSCHEL-related homeobox 9-like [... 46 5e-06 >ref|XP_003542589.1| PREDICTED: WUSCHEL-related homeobox 9-like [Glycine max] Length = 399 Score = 45.8 bits (107), Expect(2) = 5e-06 Identities = 20/31 (64%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -2 Query: 236 SNPSNSNHQWQHDINPTYIST-CKRAPYESG 147 S P N +HQWQHDIN + IST C R+PY SG Sbjct: 14 SKPCNPHHQWQHDINSSLISTSCHRSPYSSG 44 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 267 AQSKRHWPSMFKPKQL*P 214 A S RHWPSMFK K P Sbjct: 2 ASSNRHWPSMFKSKPCNP 19