BLASTX nr result
ID: Cimicifuga21_contig00018283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018283 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319790.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002332642.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002280679.2| PREDICTED: uncharacterized protein LOC100260... 72 5e-11 ref|XP_003634655.1| PREDICTED: S-locus-specific glycoprotein S13... 72 5e-11 emb|CAN77806.1| hypothetical protein VITISV_036094 [Vitis vinifera] 72 5e-11 >ref|XP_002319790.1| predicted protein [Populus trichocarpa] gi|222858166|gb|EEE95713.1| predicted protein [Populus trichocarpa] Length = 836 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/68 (52%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIV-NKSESVFWSSNSSKAVENPILEFLESGNIVLRDV 178 ANR++P+ D+SG L + GN+V+V N + +V WSSNS KA ++ + E L+SGN+VLRD Sbjct: 74 ANRNNPINDSSGFLMLDNTGNLVLVSNNNSTVVWSSNSKKAAQSAMGELLDSGNLVLRDE 133 Query: 179 KDRDSGSY 202 KD +SGSY Sbjct: 134 KDVNSGSY 141 >ref|XP_002332642.1| predicted protein [Populus trichocarpa] gi|222832837|gb|EEE71314.1| predicted protein [Populus trichocarpa] Length = 820 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/68 (51%), Positives = 50/68 (73%), Gaps = 1/68 (1%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIV-NKSESVFWSSNSSKAVENPILEFLESGNIVLRDV 178 ANR++P+ D+SG L + GN+V+V N + +V WSSNS KA ++ + E L+SGN+VLRD Sbjct: 74 ANRNNPINDSSGFLMLDNTGNLVLVSNNNSTVVWSSNSKKAAQSAMGELLDSGNLVLRDE 133 Query: 179 KDRDSGSY 202 KD +SG Y Sbjct: 134 KDANSGIY 141 >ref|XP_002280679.2| PREDICTED: uncharacterized protein LOC100260657 [Vitis vinifera] Length = 1593 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIVNKSESVFWSSNSSKAVENPILEFLESGNIVLRDVK 181 ANR+SPL D+SGVLK+ G +V+VN + + W+SNSS+ E+P + LESGN+V+R Sbjct: 77 ANRESPLTDSSGVLKVTEQGILVLVNGTNGILWNSNSSRFAEDPNAQLLESGNLVMRSGN 136 Query: 182 DRDSGSY 202 D DS ++ Sbjct: 137 DSDSENF 143 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/67 (46%), Positives = 47/67 (70%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIVNKSESVFWSSNSSKAVENPILEFLESGNIVLRDVK 181 ANR+SPL D+SGVLK+ G +V+VN + + W+SNSS + +P + LESGN+V+R+ Sbjct: 873 ANRESPLTDSSGVLKVTQQGILVLVNDTNGILWNSNSSHSALDPNAQLLESGNLVMRNGN 932 Query: 182 DRDSGSY 202 D D ++ Sbjct: 933 DSDPENF 939 >ref|XP_003634655.1| PREDICTED: S-locus-specific glycoprotein S13-like [Vitis vinifera] Length = 308 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIVNKSESVFWSSNSSKAVENPILEFLESGNIVLRDVK 181 ANR++P+ D+ GVL I G +V++N+S+SV WS N S+ +ENP+ LE+GN+VLRD Sbjct: 48 ANRNNPIVDSYGVLTIINNGTLVLLNQSKSVIWSPNLSRVLENPVARLLETGNLVLRDNS 107 Query: 182 DRDSGSY 202 + S SY Sbjct: 108 NESSESY 114 >emb|CAN77806.1| hypothetical protein VITISV_036094 [Vitis vinifera] Length = 326 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/67 (49%), Positives = 48/67 (71%) Frame = +2 Query: 2 ANRDSPLYDTSGVLKIGTAGNIVIVNKSESVFWSSNSSKAVENPILEFLESGNIVLRDVK 181 ANR++P+ D+ GVL I G +V++N+S+SV WS N S+ +ENP+ LE+GN+VLRD Sbjct: 105 ANRNNPIVDSYGVLTIINNGTLVLLNQSKSVIWSPNLSRVLENPVARLLETGNLVLRDNS 164 Query: 182 DRDSGSY 202 + S SY Sbjct: 165 NESSESY 171