BLASTX nr result
ID: Cimicifuga21_contig00018274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018274 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447747.1| hypothetical protein SORBIDRAFT_06g014990 [S... 55 8e-06 >ref|XP_002447747.1| hypothetical protein SORBIDRAFT_06g014990 [Sorghum bicolor] gi|241938930|gb|EES12075.1| hypothetical protein SORBIDRAFT_06g014990 [Sorghum bicolor] Length = 982 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 308 KKLNVRGCPKLHKLPIRFDQIPADDAKIEIKGETEWWSKIKWEQDG 171 K+L+VRGC L +LP RF Q P D +E+ GE WWSK++W+QDG Sbjct: 908 KELHVRGCWSLRRLP-RFRQQP--DKAVEVSGEPAWWSKLRWDQDG 950