BLASTX nr result
ID: Cimicifuga21_contig00018260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00018260 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF06706.1| UP-9A [Nicotiana tabacum] 55 5e-06 >gb|ABF06706.1| UP-9A [Nicotiana tabacum] Length = 117 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 157 SLEREERMRQELHMTNQKLKVVEDAEERLCSQLGDLE 267 S+EREE+M+QEL T ++L+V E+AEERLCSQLG+LE Sbjct: 42 SIEREEKMKQELQKTWERLRVAEEAEERLCSQLGELE 78