BLASTX nr result
ID: Cimicifuga21_contig00017893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017893 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31496.3| unnamed protein product [Vitis vinifera] 80 2e-13 ref|XP_002488881.1| hypothetical protein SORBIDRAFT_2635s002010 ... 79 3e-13 ref|XP_002488910.1| hypothetical protein SORBIDRAFT_2002s002020 ... 79 3e-13 gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsi... 79 5e-13 gb|AGF25313.1| elongation factor 1-alpha, partial [x Doritaenops... 78 7e-13 >emb|CBI31496.3| unnamed protein product [Vitis vinifera] Length = 160 Score = 80.1 bits (196), Expect = 2e-13 Identities = 45/69 (65%), Positives = 50/69 (72%) Frame = +1 Query: 1 LIYKLGGTDKRVIERFEKEAAEMNKRSFKYAWVLDKLKDARHMSRLCMLDMGLDHSLLEK 180 LIYKLGG DKRVIERFEKEAAEMNKRSFKYAWVLDKLK R + +H+LL Sbjct: 68 LIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAEREPG-ISKDGQTREHALL-- 124 Query: 181 SFTMHARHM 207 +FT+ R M Sbjct: 125 AFTLGVRQM 133 >ref|XP_002488881.1| hypothetical protein SORBIDRAFT_2635s002010 [Sorghum bicolor] gi|241947296|gb|EES20441.1| hypothetical protein SORBIDRAFT_2635s002010 [Sorghum bicolor] Length = 125 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = +1 Query: 1 LIYKLGGTDKRVIERFEKEAAEMNKRSFKYAWVLDKLKDARHMS 132 LIYKLGG DKRVIERFEKEAAEMNKRSFKYAWVLDKLK R S Sbjct: 27 LIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAKRERS 70 >ref|XP_002488910.1| hypothetical protein SORBIDRAFT_2002s002020 [Sorghum bicolor] gi|241947249|gb|EES20394.1| hypothetical protein SORBIDRAFT_2002s002020 [Sorghum bicolor] Length = 202 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = +1 Query: 1 LIYKLGGTDKRVIERFEKEAAEMNKRSFKYAWVLDKLKDARHMS 132 LIYKLGG DKRVIERFEKEAAEMNKRSFKYAWVLDKLK R S Sbjct: 27 LIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAKRERS 70 >gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum] Length = 447 Score = 78.6 bits (192), Expect = 5e-13 Identities = 43/65 (66%), Positives = 47/65 (72%) Frame = +1 Query: 1 LIYKLGGTDKRVIERFEKEAAEMNKRSFKYAWVLDKLKDARHMSRLCMLDMGLDHSLLEK 180 LIYKLGG DKRVIERFEKEAAEMNKRSFKYAWVLDKLK R + +D +LLE Sbjct: 27 LIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERG------ITIDIALLEF 80 Query: 181 SFTMH 195 T + Sbjct: 81 ETTKY 85 >gb|AGF25313.1| elongation factor 1-alpha, partial [x Doritaenopsis hybrid cultivar] Length = 206 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = +1 Query: 1 LIYKLGGTDKRVIERFEKEAAEMNKRSFKYAWVLDKLKDAR 123 LIYKLGG DKRVIERFEKEAAEMNKRSFKYAWVLDKLK R Sbjct: 20 LIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAER 60