BLASTX nr result
ID: Cimicifuga21_contig00017533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00017533 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabi... 119 3e-25 ref|NP_181493.1| dolichyl-phosphate beta-glucosyltransferase [Ar... 119 3e-25 ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase,... 114 1e-23 ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 112 4e-23 emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] 112 4e-23 >ref|XP_002881666.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] gi|297327505|gb|EFH57925.1| glycosyl transferase family 2 protein [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 119 bits (298), Expect = 3e-25 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELALMSVGYRTGMW 182 LKRWCFDVELVYLCKRF+IPM+EISVKWSEIPGSKVS SI +MLWELALMSVGYRTGMW Sbjct: 272 LKRWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMW 331 Query: 183 EI 188 +I Sbjct: 332 KI 333 >ref|NP_181493.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|15810211|gb|AAL07006.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|18700244|gb|AAL77732.1| At2g39630/F12L6.29 [Arabidopsis thaliana] gi|20197112|gb|AAM14922.1| putative dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] gi|330254605|gb|AEC09699.1| dolichyl-phosphate beta-glucosyltransferase [Arabidopsis thaliana] Length = 336 Score = 119 bits (298), Expect = 3e-25 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELALMSVGYRTGMW 182 LKRWCFDVELVYLCKRF+IPM+EISVKWSEIPGSKVS SI +MLWELALMSVGYRTGMW Sbjct: 272 LKRWCFDVELVYLCKRFNIPMVEISVKWSEIPGSKVSMLSIPNMLWELALMSVGYRTGMW 331 Query: 183 EI 188 +I Sbjct: 332 KI 333 >ref|XP_002530857.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] gi|223529581|gb|EEF31531.1| Dolichyl-phosphate beta-glucosyltransferase, putative [Ricinus communis] Length = 335 Score = 114 bits (284), Expect = 1e-23 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELALMSVGYRTGMW 182 LKRWCFDVE+VYLCK FSIPMIEISV WSEIPGSKV+ SI +MLWELA+MS+GYRTGMW Sbjct: 272 LKRWCFDVEVVYLCKWFSIPMIEISVNWSEIPGSKVNPLSIPNMLWELAIMSIGYRTGMW 331 Query: 183 EI 188 EI Sbjct: 332 EI 333 >ref|XP_002283615.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Vitis vinifera] gi|296086237|emb|CBI31678.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 112 bits (279), Expect = 4e-23 Identities = 52/64 (81%), Positives = 56/64 (87%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELALMSVGYRTGMW 182 LKRWCFDVELVYLCK F IPMIEISV WSEIPGSKV+ SI +MLWELALMS GYRTGMW Sbjct: 273 LKRWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMW 332 Query: 183 EIQS 194 +I + Sbjct: 333 KIST 336 >emb|CAN83698.1| hypothetical protein VITISV_027543 [Vitis vinifera] Length = 251 Score = 112 bits (279), Expect = 4e-23 Identities = 52/64 (81%), Positives = 56/64 (87%) Frame = +3 Query: 3 LKRWCFDVELVYLCKRFSIPMIEISVKWSEIPGSKVSARSILHMLWELALMSVGYRTGMW 182 LKRWCFDVELVYLCK F IPMIEISV WSEIPGSKV+ SI +MLWELALMS GYRTGMW Sbjct: 188 LKRWCFDVELVYLCKWFGIPMIEISVNWSEIPGSKVNPLSIPNMLWELALMSAGYRTGMW 247 Query: 183 EIQS 194 +I + Sbjct: 248 KIST 251