BLASTX nr result
ID: Cimicifuga21_contig00016923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016923 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596245.1| Receptor-like protein kinase [Medicago trunc... 104 8e-21 ref|XP_003596244.1| Receptor-like serine/threonine kinase [Medic... 103 1e-20 ref|XP_003596231.1| Leucine-rich repeat family protein / protein... 102 4e-20 ref|XP_003516373.1| PREDICTED: probable leucine-rich repeat rece... 101 5e-20 ref|XP_003596242.1| Cysteine-rich receptor-like protein kinase [... 100 9e-20 >ref|XP_003596245.1| Receptor-like protein kinase [Medicago truncatula] gi|355485293|gb|AES66496.1| Receptor-like protein kinase [Medicago truncatula] Length = 899 Score = 104 bits (259), Expect = 8e-21 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = -2 Query: 202 TTGHPAVLTMKDYQLYMTARISPVSLTYYGFCLLRGNYTVNLHFAEIMFTNDETYSSLGR 23 +T H + LTM D QLY +AR+SP SLTYYGFCL G+YTV LHFAEIMFTND+TY SLGR Sbjct: 350 STRHISKLTMVDAQLYTSARVSPNSLTYYGFCLANGSYTVKLHFAEIMFTNDQTYGSLGR 409 Query: 22 RIFDIYI 2 R+FDIY+ Sbjct: 410 RVFDIYL 416 >ref|XP_003596244.1| Receptor-like serine/threonine kinase [Medicago truncatula] gi|355485292|gb|AES66495.1| Receptor-like serine/threonine kinase [Medicago truncatula] Length = 1208 Score = 103 bits (257), Expect = 1e-20 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = -2 Query: 208 VDTTGHPAVLTMKDYQLYMTARISPVSLTYYGFCLLRGNYTVNLHFAEIMFTNDETYSSL 29 +D + LTM D +LYM AR SP+SLTYYGFCL +G YTVNLHFAEIMFTND++Y SL Sbjct: 631 IDFPRNYTALTMADTELYMDARGSPISLTYYGFCLAKGRYTVNLHFAEIMFTNDQSYGSL 690 Query: 28 GRRIFDIYI 2 GRR+FDIY+ Sbjct: 691 GRRVFDIYL 699 >ref|XP_003596231.1| Leucine-rich repeat family protein / protein kinase family protein [Medicago truncatula] gi|355485279|gb|AES66482.1| Leucine-rich repeat family protein / protein kinase family protein [Medicago truncatula] Length = 974 Score = 102 bits (253), Expect = 4e-20 Identities = 46/60 (76%), Positives = 53/60 (88%) Frame = -2 Query: 181 LTMKDYQLYMTARISPVSLTYYGFCLLRGNYTVNLHFAEIMFTNDETYSSLGRRIFDIYI 2 LTM D +LYMTAR SP+SLTYY FCL G YTVNLHFAEIMFT+D+TY+SLGRR+FDIY+ Sbjct: 442 LTMADTELYMTARGSPISLTYYAFCLANGGYTVNLHFAEIMFTDDQTYASLGRRVFDIYL 501 >ref|XP_003516373.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Glycine max] Length = 816 Score = 101 bits (252), Expect = 5e-20 Identities = 46/60 (76%), Positives = 53/60 (88%) Frame = -2 Query: 181 LTMKDYQLYMTARISPVSLTYYGFCLLRGNYTVNLHFAEIMFTNDETYSSLGRRIFDIYI 2 L M++ +LYM AR+SP SLTYYGFCL GNYTV LHFAEIMFT+D+TYSSLGRR+FDIYI Sbjct: 280 LVMENVELYMNARVSPTSLTYYGFCLGNGNYTVKLHFAEIMFTDDKTYSSLGRRVFDIYI 339 >ref|XP_003596242.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355485290|gb|AES66493.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 1019 Score = 100 bits (250), Expect = 9e-20 Identities = 44/60 (73%), Positives = 54/60 (90%) Frame = -2 Query: 181 LTMKDYQLYMTARISPVSLTYYGFCLLRGNYTVNLHFAEIMFTNDETYSSLGRRIFDIYI 2 LTM D +LY TAR SP+SLTYYGFCL+ GNYT+NL+FAEI+FT+D+TY SLGRR+FDIY+ Sbjct: 466 LTMTDAELYTTARGSPISLTYYGFCLVNGNYTINLYFAEILFTDDQTYGSLGRRVFDIYL 525