BLASTX nr result
ID: Cimicifuga21_contig00016827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016827 (886 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616473.1| hypothetical protein MTR_5g080750 [Medicago ... 83 7e-14 ref|XP_002524220.1| conserved hypothetical protein [Ricinus comm... 80 1e-13 ref|XP_002277756.1| PREDICTED: uncharacterized protein LOC100252... 77 1e-13 ref|XP_002878040.1| hypothetical protein ARALYDRAFT_906983 [Arab... 80 8e-13 ref|XP_002300180.1| predicted protein [Populus trichocarpa] gi|2... 80 8e-13 >ref|XP_003616473.1| hypothetical protein MTR_5g080750 [Medicago truncatula] gi|355517808|gb|AES99431.1| hypothetical protein MTR_5g080750 [Medicago truncatula] Length = 63 Score = 83.2 bits (204), Expect = 7e-14 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = -3 Query: 395 KKKVVSSFQMPLHYPKYTEKDYEDMPEWKLDQLLTEYELPVTGDVAHKRECAMGDISLA 219 KK VS FQMPLHYP+YTEKDY+DMPEWKLD LL EY LP GD+A ++ G SLA Sbjct: 5 KKNNVSFFQMPLHYPRYTEKDYQDMPEWKLDGLLKEYGLPTHGDLALQKRVCYGCFSLA 63 >ref|XP_002524220.1| conserved hypothetical protein [Ricinus communis] gi|223536497|gb|EEF38144.1| conserved hypothetical protein [Ricinus communis] Length = 107 Score = 80.5 bits (197), Expect(2) = 1e-13 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -3 Query: 374 FQMPLHYPKYTEKDYEDMPEWKLDQLLTEYELPVTGDVAHKRECAMG 234 FQMP+HYP+YT+KDYE+MPEW+LD+LL +Y LP+ GD+ +KRE AMG Sbjct: 10 FQMPVHYPRYTKKDYENMPEWQLDRLLADYGLPINGDLGYKREFAMG 56 Score = 22.7 bits (47), Expect(2) = 1e-13 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Frame = -1 Query: 235 GTFLWPDTSESPRDRTKVSPRPSEKKG*LVIWH------KFKFPRVGYMFLLL 95 G+FLWPD+S + ++ K S S G H KF VG++F LL Sbjct: 56 GSFLWPDSSATYQE-PKCSSSCSSAYG---FDHDSSPCGSNKFKIVGFLFRLL 104 >ref|XP_002277756.1| PREDICTED: uncharacterized protein LOC100252954 [Vitis vinifera] gi|296086179|emb|CBI31620.3| unnamed protein product [Vitis vinifera] Length = 85 Score = 77.4 bits (189), Expect(2) = 1e-13 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -3 Query: 404 MEGKKKVV--SSFQMPLHYPKYTEKDYEDMPEWKLDQLLTEYELPVTGDVAHKRECAMG 234 ME KK S FQMPLHYP+YT KDY+DMPEW+LD LL +Y L GD+A+KR+ AMG Sbjct: 1 MESKKDSGGGSFFQMPLHYPRYTRKDYQDMPEWQLDTLLRQYGLSTHGDLAYKRDFAMG 59 Score = 25.8 bits (55), Expect(2) = 1e-13 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 235 GTFLWPDTSESPRDRT 188 GTFLWPD + +P T Sbjct: 59 GTFLWPDPTSTPNYHT 74 >ref|XP_002878040.1| hypothetical protein ARALYDRAFT_906983 [Arabidopsis lyrata subsp. lyrata] gi|297323878|gb|EFH54299.1| hypothetical protein ARALYDRAFT_906983 [Arabidopsis lyrata subsp. lyrata] Length = 139 Score = 79.7 bits (195), Expect = 8e-13 Identities = 33/58 (56%), Positives = 45/58 (77%) Frame = -3 Query: 407 LMEGKKKVVSSFQMPLHYPKYTEKDYEDMPEWKLDQLLTEYELPVTGDVAHKRECAMG 234 + GK S F+MPLHYP+Y++KDY+DMPEWKLD++L +Y L GD+AHKR+ A+G Sbjct: 51 VQNGKNGEASVFRMPLHYPRYSKKDYQDMPEWKLDRVLADYGLSTYGDLAHKRDFAIG 108 >ref|XP_002300180.1| predicted protein [Populus trichocarpa] gi|222847438|gb|EEE84985.1| predicted protein [Populus trichocarpa] Length = 73 Score = 79.7 bits (195), Expect = 8e-13 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -3 Query: 395 KKKVVSSFQMPLHYPKYTEKDYEDMPEWKLDQLLTEYELPVTGDVAHKRECAMG 234 KK + FQMPLHYPKY+ KDY+ MPEW+LD+LL +Y LPV D+A+KRE AMG Sbjct: 5 KKNDANCFQMPLHYPKYSMKDYQTMPEWQLDRLLADYGLPVHNDLAYKREFAMG 58