BLASTX nr result
ID: Cimicifuga21_contig00016818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016818 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276726.1| PREDICTED: regulation of nuclear pre-mRNA do... 55 4e-06 ref|XP_002528993.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002276726.1| PREDICTED: regulation of nuclear pre-mRNA domain-containing protein 2-like [Vitis vinifera] Length = 524 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +3 Query: 51 QSIQMIQQPPAPPSFRPLQPPGMLYYTHPHHNQ 149 Q + + QQPPAPPSFRPLQ PGM+YY PHH+Q Sbjct: 492 QPMPLTQQPPAPPSFRPLQLPGMVYYGLPHHSQ 524 >ref|XP_002528993.1| conserved hypothetical protein [Ricinus communis] gi|223531583|gb|EEF33412.1| conserved hypothetical protein [Ricinus communis] Length = 514 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +3 Query: 48 QQSIQMIQQPPAPPSFRPLQPPGMLYYTHPHHN 146 QQ + + QQ P PPSFRPLQPPGM+YY HP H+ Sbjct: 482 QQPMPLTQQAPGPPSFRPLQPPGMVYYGHPPHS 514