BLASTX nr result
ID: Cimicifuga21_contig00016309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00016309 (810 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270296.1| PREDICTED: uncharacterized protein LOC100258... 67 4e-14 emb|CBI32011.3| unnamed protein product [Vitis vinifera] 67 4e-14 ref|XP_002314720.1| predicted protein [Populus trichocarpa] gi|2... 66 6e-14 ref|XP_002871929.1| zinc knuckle (CCHC-type) family protein [Ara... 60 2e-12 gb|AAM62689.1| zinc finger protein [Arabidopsis thaliana] 60 2e-12 >ref|XP_002270296.1| PREDICTED: uncharacterized protein LOC100258796 [Vitis vinifera] Length = 387 Score = 67.0 bits (162), Expect(2) = 4e-14 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 210 RCQLCGQKGHNLRTCPNSRPPESKRRDTRYHHCQVCGQGGRNRRTRP 350 RC+LCG+KGHN RTC SR ++ +R+HHC++CG G NRRT P Sbjct: 297 RCRLCGEKGHNRRTCRRSRESGTRSTVSRHHHCRICGHSGHNRRTCP 343 Score = 37.4 bits (85), Expect(2) = 4e-14 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +2 Query: 116 GMKFYCGNCGTEGHRRN*FPNL 181 G KFYC NCG EGHRR+ P L Sbjct: 266 GAKFYCKNCGREGHRRHYCPEL 287 >emb|CBI32011.3| unnamed protein product [Vitis vinifera] Length = 377 Score = 67.0 bits (162), Expect(2) = 4e-14 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 210 RCQLCGQKGHNLRTCPNSRPPESKRRDTRYHHCQVCGQGGRNRRTRP 350 RC+LCG+KGHN RTC SR ++ +R+HHC++CG G NRRT P Sbjct: 287 RCRLCGEKGHNRRTCRRSRESGTRSTVSRHHHCRICGHSGHNRRTCP 333 Score = 37.4 bits (85), Expect(2) = 4e-14 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +2 Query: 116 GMKFYCGNCGTEGHRRN*FPNL 181 G KFYC NCG EGHRR+ P L Sbjct: 256 GAKFYCKNCGREGHRRHYCPEL 277 >ref|XP_002314720.1| predicted protein [Populus trichocarpa] gi|222863760|gb|EEF00891.1| predicted protein [Populus trichocarpa] Length = 259 Score = 65.9 bits (159), Expect(2) = 6e-14 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 210 RCQLCGQKGHNLRTCPNSRPPESKRRDTRYHHCQVCGQGGRNRRTRPLSIEI 365 +C+LCG+KGHN RTCP SR K + T +H C++C QGG NRR+ P + I Sbjct: 171 KCRLCGKKGHNRRTCPKSRMSNHKGKVTWHHRCRICRQGGHNRRSCPQVVGI 222 Score = 37.7 bits (86), Expect(2) = 6e-14 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 116 GMKFYCGNCGTEGHRRN*FPNL 181 G+KFYC NCG EGHR++ P L Sbjct: 140 GVKFYCSNCGREGHRKHYCPEL 161 >ref|XP_002871929.1| zinc knuckle (CCHC-type) family protein [Arabidopsis lyrata subsp. lyrata] gi|297317766|gb|EFH48188.1| zinc knuckle (CCHC-type) family protein [Arabidopsis lyrata subsp. lyrata] Length = 404 Score = 59.7 bits (143), Expect(2) = 2e-12 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +3 Query: 210 RCQLCGQKGHNLRTCPNSRPPESKRRDTRYHHCQVCGQGGRNRRT 344 RC+ CG KGHN RTCP S+ +K TR+H C +CG+ G N RT Sbjct: 302 RCRGCGGKGHNRRTCPKSKSMVTKGISTRHHQCGICGESGHNSRT 346 Score = 38.9 bits (89), Expect(2) = 2e-12 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +2 Query: 29 KKH*SKKEHRNLSSIDKTGTNSNQAESGSGMKFYCGNCGTEGHRRN*FPNL 181 +KH S+ S D ++ S G+KFYC NCG EGHRR+ P L Sbjct: 246 RKHASESMKAFFSDPDN---REQRSLSMKGVKFYCKNCGQEGHRRHYCPEL 293 >gb|AAM62689.1| zinc finger protein [Arabidopsis thaliana] Length = 393 Score = 60.5 bits (145), Expect(2) = 2e-12 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 210 RCQLCGQKGHNLRTCPNSRPPESKRRDTRYHHCQVCGQGGRNRRT 344 RC+ CG KGHN RTCP S+ +K TRYH C +CG+ G N RT Sbjct: 291 RCRGCGGKGHNRRTCPKSKSIVTKSISTRYHKCGICGERGHNSRT 335 Score = 37.7 bits (86), Expect(2) = 2e-12 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +2 Query: 107 SGSGMKFYCGNCGTEGHRRN*FPNL 181 S G KFYC NCG EGHRR+ P L Sbjct: 258 SMKGTKFYCKNCGQEGHRRHYCPEL 282