BLASTX nr result
ID: Cimicifuga21_contig00015759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015759 (840 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002875239.1| GDSL-motif lipase/hydrolase family protein [... 80 4e-13 ref|NP_178483.1| GDSL esterase/lipase [Arabidopsis thaliana] gi|... 80 7e-13 ref|NP_974125.1| GDSL esterase/lipase [Arabidopsis thaliana] gi|... 76 1e-11 ref|XP_002888840.1| GDSL-motif lipase/hydrolase family protein [... 76 1e-11 ref|XP_002963881.1| hypothetical protein SELMODRAFT_80725 [Selag... 75 1e-11 >ref|XP_002875239.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] gi|297321077|gb|EFH51498.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] Length = 366 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/65 (60%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -1 Query: 582 YGIDFPAG-ATGRFTNGRNFVDFIAQLLGLPLVPAYLGLSAVDKSKLTTRINYASGAANI 406 YG DF G ATGRF+NG+ D+IA GLPLVPAY+GLS +K+ +TT INYAS + I Sbjct: 71 YGSDFEGGKATGRFSNGKTIADYIAIYYGLPLVPAYMGLSEEEKNNITTGINYASASCGI 130 Query: 405 LPETG 391 LP+TG Sbjct: 131 LPDTG 135 >ref|NP_178483.1| GDSL esterase/lipase [Arabidopsis thaliana] gi|75206097|sp|Q9SIF5.1|GDL32_ARATH RecName: Full=GDSL esterase/lipase At2g03980; AltName: Full=Extracellular lipase At2g03980; Flags: Precursor gi|4914384|gb|AAD32919.1| putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana] gi|21537138|gb|AAM61479.1| putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana] gi|110737500|dbj|BAF00692.1| putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana] gi|330250681|gb|AEC05775.1| GDSL esterase/lipase [Arabidopsis thaliana] Length = 367 Score = 79.7 bits (195), Expect = 7e-13 Identities = 40/68 (58%), Positives = 48/68 (70%), Gaps = 1/68 (1%) Frame = -1 Query: 582 YGIDFPAG-ATGRFTNGRNFVDFIAQLLGLPLVPAYLGLSAVDKSKLTTRINYASGAANI 406 YG DF G ATGRF+NG+ D+IA GLPLVPAYLGLS +K+ ++T INYAS I Sbjct: 71 YGSDFEGGKATGRFSNGKTIADYIAIYYGLPLVPAYLGLSQEEKNSISTGINYASAGCGI 130 Query: 405 LPETGTGI 382 LP+TG I Sbjct: 131 LPQTGRQI 138 >ref|NP_974125.1| GDSL esterase/lipase [Arabidopsis thaliana] gi|75204334|sp|Q9SF78.1|GDL29_ARATH RecName: Full=GDSL esterase/lipase At1g71691; AltName: Full=Extracellular lipase At1g71691; Flags: Precursor gi|7239493|gb|AAF43219.1|AC012654_3 Strong similarity to the putative GDSL-motif containing lipase/hydrolase F26A9.7 from A. thaliana on BAC gb|AC016163 [Arabidopsis thaliana] gi|12323716|gb|AAG51812.1|AC016163_1 putative GDSL-motif lipase/hydrolase; 24593-26678 [Arabidopsis thaliana] gi|332197093|gb|AEE35214.1| GDSL esterase/lipase [Arabidopsis thaliana] Length = 384 Score = 75.9 bits (185), Expect = 1e-11 Identities = 40/69 (57%), Positives = 45/69 (65%) Frame = -1 Query: 582 YGIDFPAGATGRFTNGRNFVDFIAQLLGLPLVPAYLGLSAVDKSKLTTRINYASGAANIL 403 YGIDF G TGRF NG VD IAQLLGLPL+PAY S ++ +NYAS AA IL Sbjct: 83 YGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAY---SEATGDQVLRGVNYASAAAGIL 139 Query: 402 PETGTGIVG 376 P+TG VG Sbjct: 140 PDTGGNFVG 148 >ref|XP_002888840.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334681|gb|EFH65099.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] Length = 384 Score = 75.9 bits (185), Expect = 1e-11 Identities = 40/69 (57%), Positives = 45/69 (65%) Frame = -1 Query: 582 YGIDFPAGATGRFTNGRNFVDFIAQLLGLPLVPAYLGLSAVDKSKLTTRINYASGAANIL 403 YGIDF G TGRF NG VD IAQLLGLPL+PAY S ++ +NYAS AA IL Sbjct: 83 YGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAY---SEATGDQVLRGVNYASAAAGIL 139 Query: 402 PETGTGIVG 376 P+TG VG Sbjct: 140 PDTGGNFVG 148 >ref|XP_002963881.1| hypothetical protein SELMODRAFT_80725 [Selaginella moellendorffii] gi|300169149|gb|EFJ35752.1| hypothetical protein SELMODRAFT_80725 [Selaginella moellendorffii] Length = 348 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -1 Query: 579 GIDFPAGATGRFTNGRNFVDFIAQLLGLPLVPAYLGLSAVDKSKLTTRINYASGAANILP 400 GIDFP GATGRF+NGR VD + +L+GLPLVP YL SA SK+ ++YASGAA I Sbjct: 45 GIDFPLGATGRFSNGRTVVDVVGELIGLPLVPPYLDPSA-KGSKILQGVSYASGAAGIED 103 Query: 399 ETG 391 ETG Sbjct: 104 ETG 106