BLASTX nr result
ID: Cimicifuga21_contig00015425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015425 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222261.1| hypothetical protein BevumaM_p022 [Beta vulg... 97 8e-32 emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] 107 1e-21 >ref|YP_004222261.1| hypothetical protein BevumaM_p022 [Beta vulgaris subsp. maritima] gi|346683138|ref|YP_004842068.1| hypothetical protein BemaM_p020 [Beta macrocarpa] gi|317905698|emb|CBX33237.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439778|emb|CBX33289.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148010|emb|CBJ20676.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500056|emb|CBX24872.1| hypothetical protein [Beta macrocarpa] gi|384939212|emb|CBL52058.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 134 Score = 97.4 bits (241), Expect(2) = 8e-32 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +3 Query: 3 QRALGCGGAIIAQLPNLMRHRVRTAGNRSMGGRLILLPPQGWLIVRSR 146 QRALGCGGAIIAQLPNLMRHRVRTAGNRSMGGRLILLP QGWLIVRSR Sbjct: 57 QRALGCGGAIIAQLPNLMRHRVRTAGNRSMGGRLILLPSQGWLIVRSR 104 Score = 64.7 bits (156), Expect(2) = 8e-32 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 154 ELPWFWKAHESERYYECATDTTLRRYLCR 240 E PWFWKAHESERY ECATDTTLRRYLCR Sbjct: 106 EDPWFWKAHESERYVECATDTTLRRYLCR 134 >emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] Length = 291 Score = 107 bits (267), Expect = 1e-21 Identities = 57/83 (68%), Positives = 57/83 (68%) Frame = -1 Query: 250 RRLTCTGTYVV*CRSHIHNSVRTHVPSRTRGVPLLLLRTISQPCGGKRIRRPPMLRFPAV 71 RRLTCTGTY S LLRTISQPCG KRIRRPPMLRFPAV Sbjct: 209 RRLTCTGTYNQGSSS--------------------LLRTISQPCGVKRIRRPPMLRFPAV 248 Query: 70 RTRCRIRLGSWAIIAPPHPKARC 2 RTRCRIRLGSWAIIAPPHPKARC Sbjct: 249 RTRCRIRLGSWAIIAPPHPKARC 271