BLASTX nr result
ID: Cimicifuga21_contig00015283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015283 (652 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus comm... 93 5e-17 gb|AAN76363.1| type I proteinase inhibitor-like protein [Citrus ... 92 1e-16 gb|AFP43221.1| proteinase inhibitor [Gossypium arboreum] gi|3992... 92 1e-16 ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus comm... 89 5e-16 ref|XP_002334124.1| predicted protein [Populus trichocarpa] gi|2... 89 7e-16 >ref|XP_002521007.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539844|gb|EEF41424.1| Proteinase inhibitor, putative [Ricinus communis] Length = 70 Score = 92.8 bits (229), Expect = 5e-17 Identities = 42/68 (61%), Positives = 53/68 (77%) Frame = -2 Query: 504 SLCPGKKLWPELVGSDGGAAAARIEKEMPHVHAIVVLEGTPVTMDYRCDRVWVRVDKRGK 325 ++C GK WPELVG+ G AAA +EKE HVHAIV+ EGTPVT D+RC+RVWV VD+ G Sbjct: 3 NVCLGKDSWPELVGAKGDDAAATVEKENKHVHAIVLKEGTPVTRDFRCNRVWVWVDENGV 62 Query: 324 VTQSPRIG 301 VT++P+ G Sbjct: 63 VTRAPKTG 70 >gb|AAN76363.1| type I proteinase inhibitor-like protein [Citrus x paradisi] Length = 128 Score = 91.7 bits (226), Expect = 1e-16 Identities = 46/66 (69%), Positives = 51/66 (77%) Frame = -2 Query: 498 CPGKKLWPELVGSDGGAAAARIEKEMPHVHAIVVLEGTPVTMDYRCDRVWVRVDKRGKVT 319 CP K WPELVG +G AAA IEKE P VHAIV+LEGTPVT DYR DRV V V+K+GKV Sbjct: 63 CPRKSSWPELVGKNGEVAAAIIEKENPCVHAIVLLEGTPVTKDYRIDRVRVWVNKKGKVI 122 Query: 318 QSPRIG 301 + PRIG Sbjct: 123 RVPRIG 128 >gb|AFP43221.1| proteinase inhibitor [Gossypium arboreum] gi|399240830|gb|AFP43222.1| proteinase inhibitor [Gossypium arboreum] Length = 69 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/69 (62%), Positives = 49/69 (71%) Frame = -2 Query: 507 MSLCPGKKLWPELVGSDGGAAAARIEKEMPHVHAIVVLEGTPVTMDYRCDRVWVRVDKRG 328 MS CPGK WPELVG DG A IE+E +V AIV+L+GTPVT D+RCDRVWV VD G Sbjct: 1 MSGCPGKNSWPELVGKDGEGAKTTIERENSNVDAIVLLDGTPVTRDFRCDRVWVWVDSNG 60 Query: 327 KVTQSPRIG 301 V + P IG Sbjct: 61 HVVRPPTIG 69 >ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539843|gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis] Length = 69 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/69 (62%), Positives = 52/69 (75%) Frame = -2 Query: 507 MSLCPGKKLWPELVGSDGGAAAARIEKEMPHVHAIVVLEGTPVTMDYRCDRVWVRVDKRG 328 M+ C GK WPELVG++G AAA IEKE +V AIV+ EGTPVT D+RC RVWV VD+ G Sbjct: 1 MADCLGKNSWPELVGANGDEAAAAIEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENG 60 Query: 327 KVTQSPRIG 301 VT++P IG Sbjct: 61 VVTRTPTIG 69 >ref|XP_002334124.1| predicted protein [Populus trichocarpa] gi|222869703|gb|EEF06834.1| predicted protein [Populus trichocarpa] Length = 72 Score = 89.0 bits (219), Expect = 7e-16 Identities = 40/66 (60%), Positives = 52/66 (78%) Frame = -2 Query: 498 CPGKKLWPELVGSDGGAAAARIEKEMPHVHAIVVLEGTPVTMDYRCDRVWVRVDKRGKVT 319 C GK WPEL+G++G AAA IE+E P V AI+VL+G+ V++D+RCDRVWV VD+RG V Sbjct: 7 CQGKSSWPELLGAEGKVAAATIERENPLVEAIIVLDGSEVSLDFRCDRVWVWVDERGIVI 66 Query: 318 QSPRIG 301 + PRIG Sbjct: 67 EVPRIG 72