BLASTX nr result
ID: Cimicifuga21_contig00015253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00015253 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulga... 56 3e-06 >emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1383 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +2 Query: 47 RAELFTWKRLLDILPTKERLNRI--FPIIDTKCVLCNAPLETLHHLLLTCPYTKAVW 211 R E+F W LL+ + TK +L RI PI D CV CN LET +HLLL C ++ +W Sbjct: 1058 RVEIFCWLALLEKINTKSKLGRIGIIPIEDAVCVFCNIGLETTNHLLLHCEFSWKLW 1114