BLASTX nr result
ID: Cimicifuga21_contig00014810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00014810 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40215.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002267472.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >emb|CBI40215.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/67 (46%), Positives = 40/67 (59%) Frame = -1 Query: 201 SSPCRTTGRLLQHLRSFYASSLPSSQNPCNELYLCNKRIQELGRLGEVDQARQLFDEMFH 22 S+P R L R SLP + P L+ CN RIQELGRLG V++AR++F+EM Sbjct: 8 STPYPVIRRFLCTFRCISTLSLPIQETPQTHLFQCNTRIQELGRLGRVEEARRVFNEMIQ 67 Query: 21 RDSGTWN 1 RD +WN Sbjct: 68 RDVVSWN 74 >ref|XP_002267472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 1058 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 5/64 (7%) Frame = -1 Query: 177 RLLQHLRSF-----YASSLPSSQNPCNELYLCNKRIQELGRLGEVDQARQLFDEMFHRDS 13 R + +L+ F + S + + P L+ CN RIQELGRLG V++AR++F+EM RD Sbjct: 143 RWMDYLQQFKFVIRHKSGAKNKETPQTHLFQCNTRIQELGRLGRVEEARRVFNEMIQRDV 202 Query: 12 GTWN 1 +WN Sbjct: 203 VSWN 206