BLASTX nr result
ID: Cimicifuga21_contig00014805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00014805 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549459.1| PREDICTED: 5'-3' exoribonuclease 3-like [Gly... 133 2e-29 gb|AFW61092.1| hypothetical protein ZEAMMB73_651968 [Zea mays] 132 4e-29 gb|AFW61091.1| hypothetical protein ZEAMMB73_651968 [Zea mays] 132 4e-29 tpg|DAA54014.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea m... 131 5e-29 tpg|DAA54013.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea m... 131 5e-29 >ref|XP_003549459.1| PREDICTED: 5'-3' exoribonuclease 3-like [Glycine max] Length = 1065 Score = 133 bits (334), Expect = 2e-29 Identities = 61/69 (88%), Positives = 65/69 (94%) Frame = -1 Query: 207 AANCEGKAKRKSGEFDEKGEGAVMPKKPYQFLNIWTLREYLEYEFRIPNPPFEIDLECIV 28 AANCEGKAKRK+GEFDEKGE A++ KKP+QFLNIWTLREYLEYE RIPNPPFEID ECIV Sbjct: 273 AANCEGKAKRKAGEFDEKGE-AIVAKKPFQFLNIWTLREYLEYEMRIPNPPFEIDFECIV 331 Query: 27 DDFIFMCFF 1 DDFIFMCFF Sbjct: 332 DDFIFMCFF 340 >gb|AFW61092.1| hypothetical protein ZEAMMB73_651968 [Zea mays] Length = 1079 Score = 132 bits (331), Expect = 4e-29 Identities = 60/69 (86%), Positives = 66/69 (95%) Frame = -1 Query: 207 AANCEGKAKRKSGEFDEKGEGAVMPKKPYQFLNIWTLREYLEYEFRIPNPPFEIDLECIV 28 AANCEGKAKRK+GE+DEKGE A++PKKPYQFLNIWTLREYLEYEFR+PNPPF+ID E IV Sbjct: 274 AANCEGKAKRKAGEYDEKGE-AIVPKKPYQFLNIWTLREYLEYEFRMPNPPFQIDFERIV 332 Query: 27 DDFIFMCFF 1 DDFIFMCFF Sbjct: 333 DDFIFMCFF 341 >gb|AFW61091.1| hypothetical protein ZEAMMB73_651968 [Zea mays] Length = 1058 Score = 132 bits (331), Expect = 4e-29 Identities = 60/69 (86%), Positives = 66/69 (95%) Frame = -1 Query: 207 AANCEGKAKRKSGEFDEKGEGAVMPKKPYQFLNIWTLREYLEYEFRIPNPPFEIDLECIV 28 AANCEGKAKRK+GE+DEKGE A++PKKPYQFLNIWTLREYLEYEFR+PNPPF+ID E IV Sbjct: 274 AANCEGKAKRKAGEYDEKGE-AIVPKKPYQFLNIWTLREYLEYEFRMPNPPFQIDFERIV 332 Query: 27 DDFIFMCFF 1 DDFIFMCFF Sbjct: 333 DDFIFMCFF 341 >tpg|DAA54014.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea mays] Length = 1066 Score = 131 bits (330), Expect = 5e-29 Identities = 60/69 (86%), Positives = 65/69 (94%) Frame = -1 Query: 207 AANCEGKAKRKSGEFDEKGEGAVMPKKPYQFLNIWTLREYLEYEFRIPNPPFEIDLECIV 28 AANCEGK KRK+GEFDEKG GA++PKKPYQFLNIWTLREYLEYEFR+PNPPF+ID E IV Sbjct: 274 AANCEGKVKRKAGEFDEKG-GAIVPKKPYQFLNIWTLREYLEYEFRMPNPPFKIDFERIV 332 Query: 27 DDFIFMCFF 1 DDFIFMCFF Sbjct: 333 DDFIFMCFF 341 >tpg|DAA54013.1| TPA: hypothetical protein ZEAMMB73_402768 [Zea mays] Length = 591 Score = 131 bits (330), Expect = 5e-29 Identities = 60/69 (86%), Positives = 65/69 (94%) Frame = -1 Query: 207 AANCEGKAKRKSGEFDEKGEGAVMPKKPYQFLNIWTLREYLEYEFRIPNPPFEIDLECIV 28 AANCEGK KRK+GEFDEKG GA++PKKPYQFLNIWTLREYLEYEFR+PNPPF+ID E IV Sbjct: 274 AANCEGKVKRKAGEFDEKG-GAIVPKKPYQFLNIWTLREYLEYEFRMPNPPFKIDFERIV 332 Query: 27 DDFIFMCFF 1 DDFIFMCFF Sbjct: 333 DDFIFMCFF 341