BLASTX nr result
ID: Cimicifuga21_contig00014464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00014464 (580 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC76567.1| hypothetical protein OsI_14395 [Oryza sativa Indi... 209 4e-52 gb|AAS01974.1| putative chloroplastic RNA-binding protein, with ... 209 4e-52 ref|XP_002517623.1| conserved hypothetical protein [Ricinus comm... 207 8e-52 ref|XP_003559110.1| PREDICTED: pentatricopeptide repeat-containi... 207 1e-51 ref|XP_003546039.1| PREDICTED: uncharacterized protein LOC100781... 206 2e-51 >gb|EEC76567.1| hypothetical protein OsI_14395 [Oryza sativa Indica Group] gi|222626199|gb|EEE60331.1| hypothetical protein OsJ_13429 [Oryza sativa Japonica Group] Length = 147 Score = 209 bits (531), Expect = 4e-52 Identities = 97/109 (88%), Positives = 106/109 (97%) Frame = -2 Query: 579 EERLHWRTFLVKLGADNLKGAKNEELFVASHKSVYIVYTVLGDVCIYVVGKDDYDELALS 400 EERLHWR+FLVKLGADNLKGAKNEEL VASHKSV IVYT++GDVC+Y+VGKD+YDELAL+ Sbjct: 25 EERLHWRSFLVKLGADNLKGAKNEELLVASHKSVSIVYTMIGDVCLYIVGKDEYDELALA 84 Query: 399 EVIFVITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGILENTDKD 253 EVIF ITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKG+LENT+KD Sbjct: 85 EVIFAITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGLLENTEKD 133 >gb|AAS01974.1| putative chloroplastic RNA-binding protein, with alternative splicing isoforms [Oryza sativa Japonica Group] gi|108712189|gb|ABF99984.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] Length = 884 Score = 209 bits (531), Expect = 4e-52 Identities = 97/109 (88%), Positives = 106/109 (97%) Frame = -2 Query: 579 EERLHWRTFLVKLGADNLKGAKNEELFVASHKSVYIVYTVLGDVCIYVVGKDDYDELALS 400 EERLHWR+FLVKLGADNLKGAKNEEL VASHKSV IVYT++GDVC+Y+VGKD+YDELAL+ Sbjct: 762 EERLHWRSFLVKLGADNLKGAKNEELLVASHKSVSIVYTMIGDVCLYIVGKDEYDELALA 821 Query: 399 EVIFVITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGILENTDKD 253 EVIF ITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKG+LENT+KD Sbjct: 822 EVIFAITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGLLENTEKD 870 >ref|XP_002517623.1| conserved hypothetical protein [Ricinus communis] gi|223543255|gb|EEF44787.1| conserved hypothetical protein [Ricinus communis] Length = 147 Score = 207 bits (528), Expect = 8e-52 Identities = 98/109 (89%), Positives = 105/109 (96%) Frame = -2 Query: 579 EERLHWRTFLVKLGADNLKGAKNEELFVASHKSVYIVYTVLGDVCIYVVGKDDYDELALS 400 EERLHWR+FLVKLGADNLKG KNEEL VASHKSVYIVYTVLGDV I+VVGKD+YDELAL+ Sbjct: 25 EERLHWRSFLVKLGADNLKGVKNEELLVASHKSVYIVYTVLGDVSIFVVGKDEYDELALA 84 Query: 399 EVIFVITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGILENTDKD 253 EVIF ITSAVKDVCGKPPTERLFLDKYG+ICLCLDEIVWKG+LENTD+D Sbjct: 85 EVIFAITSAVKDVCGKPPTERLFLDKYGKICLCLDEIVWKGLLENTDRD 133 >ref|XP_003559110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Brachypodium distachyon] Length = 875 Score = 207 bits (526), Expect = 1e-51 Identities = 95/109 (87%), Positives = 106/109 (97%) Frame = -2 Query: 579 EERLHWRTFLVKLGADNLKGAKNEELFVASHKSVYIVYTVLGDVCIYVVGKDDYDELALS 400 EERLHWR+FLVKLG++NLKGAKNEEL VASHKSV IVYT++GDVC+Y+VGKD+YDELALS Sbjct: 753 EERLHWRSFLVKLGSENLKGAKNEELLVASHKSVSIVYTMIGDVCLYIVGKDEYDELALS 812 Query: 399 EVIFVITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGILENTDKD 253 EVIF +TSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKG+LENT+KD Sbjct: 813 EVIFAVTSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGLLENTEKD 861 >ref|XP_003546039.1| PREDICTED: uncharacterized protein LOC100781055 [Glycine max] Length = 147 Score = 206 bits (525), Expect = 2e-51 Identities = 99/109 (90%), Positives = 104/109 (95%) Frame = -2 Query: 579 EERLHWRTFLVKLGADNLKGAKNEELFVASHKSVYIVYTVLGDVCIYVVGKDDYDELALS 400 EERLHWR+FLVKLGADNLKG KNEEL VA HKSVYIVYTVLGDV IYVVGK++YDELALS Sbjct: 25 EERLHWRSFLVKLGADNLKGVKNEELLVACHKSVYIVYTVLGDVSIYVVGKEEYDELALS 84 Query: 399 EVIFVITSAVKDVCGKPPTERLFLDKYGRICLCLDEIVWKGILENTDKD 253 EVIFVITSAVKDVCGKPP+ERLFLDKYGRICLCLDEIVWKG LENT+KD Sbjct: 85 EVIFVITSAVKDVCGKPPSERLFLDKYGRICLCLDEIVWKGYLENTEKD 133