BLASTX nr result
ID: Cimicifuga21_contig00014347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00014347 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529338.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|NP_001030741.1| Acid phosphatase/vanadium-dependent halopero... 64 2e-08 ref|NP_188798.2| Acid phosphatase/vanadium-dependent haloperoxid... 64 2e-08 ref|XP_002321138.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002885453.1| hypothetical protein ARALYDRAFT_898610 [Arab... 62 4e-08 >ref|XP_002529338.1| conserved hypothetical protein [Ricinus communis] gi|223531209|gb|EEF33055.1| conserved hypothetical protein [Ricinus communis] Length = 173 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 259 PLSNVRPLRELLGHTPLQVVAGAILGCVVSYTMRTS 152 PLS+VRPLRELLGHTPLQVVAG++LGC+V+Y MR + Sbjct: 137 PLSSVRPLRELLGHTPLQVVAGSLLGCIVAYLMRNT 172 >ref|NP_001030741.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein [Arabidopsis thaliana] gi|332643009|gb|AEE76530.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein [Arabidopsis thaliana] Length = 122 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 259 PLSNVRPLRELLGHTPLQVVAGAILGCVVSYTMRTS 152 PLS VRPLRELLGHTP+QV AG ILGCVV+Y MR+S Sbjct: 86 PLSTVRPLRELLGHTPIQVAAGGILGCVVAYLMRSS 121 >ref|NP_188798.2| Acid phosphatase/vanadium-dependent haloperoxidase-related protein [Arabidopsis thaliana] gi|22135978|gb|AAM91571.1| unknown protein [Arabidopsis thaliana] gi|23198278|gb|AAN15666.1| unknown protein [Arabidopsis thaliana] gi|332643008|gb|AEE76529.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein [Arabidopsis thaliana] Length = 174 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 259 PLSNVRPLRELLGHTPLQVVAGAILGCVVSYTMRTS 152 PLS VRPLRELLGHTP+QV AG ILGCVV+Y MR+S Sbjct: 138 PLSTVRPLRELLGHTPIQVAAGGILGCVVAYLMRSS 173 >ref|XP_002321138.1| predicted protein [Populus trichocarpa] gi|222861911|gb|EEE99453.1| predicted protein [Populus trichocarpa] Length = 179 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 259 PLSNVRPLRELLGHTPLQVVAGAILGCVVSYTMRTS 152 PLS+ RPLRELLGHTPLQVVAGAILGC+V Y MR + Sbjct: 143 PLSSSRPLRELLGHTPLQVVAGAILGCIVGYLMRNT 178 >ref|XP_002885453.1| hypothetical protein ARALYDRAFT_898610 [Arabidopsis lyrata subsp. lyrata] gi|297331293|gb|EFH61712.1| hypothetical protein ARALYDRAFT_898610 [Arabidopsis lyrata subsp. lyrata] Length = 174 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 259 PLSNVRPLRELLGHTPLQVVAGAILGCVVSYTMRTS 152 PLS VRPLRELLGHTP+QV AG ILGCVV+Y MR++ Sbjct: 138 PLSTVRPLRELLGHTPIQVAAGGILGCVVAYLMRST 173