BLASTX nr result
ID: Cimicifuga21_contig00013904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013904 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325681.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 ref|XP_002319935.1| predicted protein [Populus trichocarpa] gi|2... 78 6e-13 dbj|BAI49720.1| putative MYB transcription factor [Diospyros kaki] 77 2e-12 ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_004144570.1| PREDICTED: transcription factor MYB86-like [... 73 2e-11 >ref|XP_002325681.1| predicted protein [Populus trichocarpa] gi|222862556|gb|EEF00063.1| predicted protein [Populus trichocarpa] Length = 250 Score = 80.5 bits (197), Expect = 1e-13 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 133 KTELRRGAWTPEEDRLLSSYIKRYGHWNWREVPKHAGLQRCGKS 2 KTEL++GAWTPEED L +Y+ RYG WNWR++PK+AGLQRCGKS Sbjct: 9 KTELKKGAWTPEEDMKLMAYVTRYGSWNWRQLPKYAGLQRCGKS 52 >ref|XP_002319935.1| predicted protein [Populus trichocarpa] gi|222858311|gb|EEE95858.1| predicted protein [Populus trichocarpa] Length = 256 Score = 78.2 bits (191), Expect = 6e-13 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = -3 Query: 133 KTELRRGAWTPEEDRLLSSYIKRYGHWNWREVPKHAGLQRCGKS 2 KT L++GAWTPEEDR L +Y+ RYG WNWR++PK AGLQRCGKS Sbjct: 9 KTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKS 52 >dbj|BAI49720.1| putative MYB transcription factor [Diospyros kaki] Length = 255 Score = 76.6 bits (187), Expect = 2e-12 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -3 Query: 157 MRKVADSGKTELRRGAWTPEEDRLLSSYIKRYGHWNWREVPKHAGLQRCGKS 2 M + A + +++GAWTPEED L +YI+RYGHWNWR++PK AGL RCGKS Sbjct: 1 MVRAARVDENGMKKGAWTPEEDEKLRAYIQRYGHWNWRQLPKFAGLSRCGKS 52 >ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|222851490|gb|EEE89037.1| predicted protein [Populus trichocarpa] Length = 287 Score = 73.6 bits (179), Expect = 2e-11 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -3 Query: 133 KTELRRGAWTPEEDRLLSSYIKRYGHWNWREVPKHAGLQRCGKS 2 K L+RG WTPEED++L SY+++YGH NWR +PK AGLQRCGKS Sbjct: 9 KMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKS 52 >ref|XP_004144570.1| PREDICTED: transcription factor MYB86-like [Cucumis sativus] Length = 254 Score = 73.2 bits (178), Expect = 2e-11 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 133 KTELRRGAWTPEEDRLLSSYIKRYGHWNWREVPKHAGLQRCGKS 2 +T +++G WTPEED+ L Y+ +YGHWNWR +PK+AGL RCGKS Sbjct: 10 ETTVKKGVWTPEEDQKLIDYVNKYGHWNWRRLPKYAGLLRCGKS 53