BLASTX nr result
ID: Cimicifuga21_contig00013571
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013571 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525557.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002525557.1| conserved hypothetical protein [Ricinus communis] gi|223535136|gb|EEF36816.1| conserved hypothetical protein [Ricinus communis] Length = 626 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 STSEGPREWTSPFAGKDLFSLPRQFVTSPSP 93 ++S G REWTSPFAGKD+FSLPRQFVTSPSP Sbjct: 596 ASSVGLREWTSPFAGKDIFSLPRQFVTSPSP 626