BLASTX nr result
ID: Cimicifuga21_contig00013369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013369 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 84 1e-14 ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 83 2e-14 ref|XP_004152744.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 83 2e-14 ref|XP_002283711.2| PREDICTED: E3 ubiquitin-protein ligase UPL2-... 83 2e-14 emb|CBI19293.3| unnamed protein product [Vitis vinifera] 83 2e-14 >ref|XP_003527888.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Glycine max] Length = 3654 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 360 SADHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 244 S+DHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE Sbjct: 3611 SSDHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 3649 >ref|XP_004163452.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3666 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 SADHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 244 S DHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE Sbjct: 3623 SPDHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 3661 >ref|XP_004152744.1| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Cucumis sativus] Length = 3656 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 SADHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 244 S DHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE Sbjct: 3613 SPDHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 3651 >ref|XP_002283711.2| PREDICTED: E3 ubiquitin-protein ligase UPL2-like [Vitis vinifera] Length = 3750 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 SADHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 244 S DHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE Sbjct: 3707 SPDHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 3745 >emb|CBI19293.3| unnamed protein product [Vitis vinifera] Length = 1824 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 360 SADHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 244 S DHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE Sbjct: 1781 SPDHLPSAHTCFNQLDLPEYPSKQHLEERLLLAIHEANE 1819