BLASTX nr result
ID: Cimicifuga21_contig00013240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013240 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528538.1| Gibberellin 3-beta-dioxygenase, putative [Ri... 78 9e-13 ref|XP_002263124.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-... 77 2e-12 emb|CAN69444.1| hypothetical protein VITISV_016474 [Vitis vinifera] 77 2e-12 ref|XP_002317640.1| 2-oxoglutarate-dependent dioxygenase [Populu... 76 3e-12 ref|XP_002298993.1| 2-oxoglutarate-dependent dioxygenase [Populu... 76 3e-12 >ref|XP_002528538.1| Gibberellin 3-beta-dioxygenase, putative [Ricinus communis] gi|223532040|gb|EEF33850.1| Gibberellin 3-beta-dioxygenase, putative [Ricinus communis] Length = 306 Score = 77.8 bits (190), Expect = 9e-13 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = -2 Query: 160 QTMLPIIDMKDFSNQSEKLVQACKEWGCFRIVNHNIPISLLSEMKSVVRSLLD 2 +T++P ID+ DF + E+L +AC+EWGCFR VNHNIP +L+SEMK VVRSLLD Sbjct: 3 KTVVPTIDVSDFPGEYERLRKACEEWGCFRAVNHNIPSALMSEMKKVVRSLLD 55 >ref|XP_002263124.1| PREDICTED: gibberellin 3-beta-dioxygenase 4-like [Vitis vinifera] Length = 298 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -2 Query: 151 LPIIDMKDFSNQSEKLVQACKEWGCFRIVNHNIPISLLSEMKSVVRSLLD 2 +P IDM+DF Q +L +AC+EWGCFR+VNH+IP SLLSEMKSVV SLLD Sbjct: 6 IPSIDMQDFPRQFRRLREACEEWGCFRVVNHSIPPSLLSEMKSVVGSLLD 55 >emb|CAN69444.1| hypothetical protein VITISV_016474 [Vitis vinifera] Length = 296 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -2 Query: 151 LPIIDMKDFSNQSEKLVQACKEWGCFRIVNHNIPISLLSEMKSVVRSLLD 2 +P IDM+DF Q +L +AC+EWGCFR+VNH+IP SLLSEMKSVV SLLD Sbjct: 6 IPSIDMQDFPRQFRRLREACEEWGCFRVVNHSIPPSLLSEMKSVVGSLLD 55 >ref|XP_002317640.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] gi|222860705|gb|EEE98252.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] Length = 297 Score = 76.3 bits (186), Expect = 3e-12 Identities = 34/54 (62%), Positives = 45/54 (83%) Frame = -2 Query: 163 GQTMLPIIDMKDFSNQSEKLVQACKEWGCFRIVNHNIPISLLSEMKSVVRSLLD 2 G++ +PIID+ +F Q EKL +AC EWGCFRIVNHNI ++L+++MK VVRSLLD Sbjct: 2 GKSGVPIIDLHEFPGQYEKLRRACVEWGCFRIVNHNISLALMADMKRVVRSLLD 55 >ref|XP_002298993.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] gi|222846251|gb|EEE83798.1| 2-oxoglutarate-dependent dioxygenase [Populus trichocarpa] Length = 297 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/54 (59%), Positives = 46/54 (85%) Frame = -2 Query: 163 GQTMLPIIDMKDFSNQSEKLVQACKEWGCFRIVNHNIPISLLSEMKSVVRSLLD 2 G++ +P ID+++F Q EKL +AC+EWGCFR+VNHNI ++L+++MK VVRSLLD Sbjct: 2 GESGVPTIDLQEFPGQYEKLRRACEEWGCFRLVNHNISLALMADMKRVVRSLLD 55