BLASTX nr result
ID: Cimicifuga21_contig00013165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013165 (1452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 70 3e-11 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 66 3e-08 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 52 7e-07 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 69.7 bits (169), Expect(2) = 3e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 1273 YACIFRLDSRIFCFSGGGEQCCLRCGRCPP 1362 YAC+FRLDSRIFCFSGGGEQC LRCGRCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 26.2 bits (56), Expect(2) = 3e-11 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 Query: 1245 RRPLSLDHYLCMY 1283 R PLSLDHY C++ Sbjct: 231 RGPLSLDHYACLF 243 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 65.9 bits (159), Expect = 3e-08 Identities = 42/107 (39%), Positives = 44/107 (41%), Gaps = 7/107 (6%) Frame = +1 Query: 1117 INEGSKAKLTGGGWSKLQ*VATPFSENRT*DWSIIRLRPELPSVGPCH*TTIYACIFRLD 1296 + G KA+LTGGGWSKL LD Sbjct: 34 VRGGPKAELTGGGWSKLH----------------------------------------LD 53 Query: 1297 SRIFCFSGGGEQCCLRCGRCP-------PERTAH*LGGLVGGGPDRR 1416 SRIFCFSGGGEQC LRCGRCP P R L GGP RR Sbjct: 54 SRIFCFSGGGEQCSLRCGRCPPVGPGLLPARKNRSLASRTSGGPIRR 100 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 51.6 bits (122), Expect(2) = 7e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -2 Query: 1364 SGGHLPQRKQHCSPPPEKQKIRES 1293 +GGHLPQRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES 317 Score = 29.3 bits (64), Expect(2) = 7e-07 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 1411 GRAPLPLVRLASERFFRA 1358 G P PLVRLASERFFRA Sbjct: 271 GNGP-PLVRLASERFFRA 287