BLASTX nr result
ID: Cimicifuga21_contig00013122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00013122 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520576.1| UDP-glucosyltransferase, putative [Ricinus c... 60 2e-07 ref|XP_002520574.1| UDP-glucosyltransferase, putative [Ricinus c... 60 2e-07 ref|XP_003617349.1| UDP-glucuronosyltransferase 1-6 [Medicago tr... 55 8e-06 >ref|XP_002520576.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223540236|gb|EEF41809.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 469 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -1 Query: 290 RGVRCIMERGSEVRRKVKETSEKCKNALMEGGSSWSSLGCLAEDLL 153 RG+RC+ME SE+R KVK+ SEK + LM+GGSS+SSL L ED++ Sbjct: 420 RGIRCVMEHDSEIRMKVKDMSEKSRKVLMDGGSSFSSLNRLIEDIV 465 >ref|XP_002520574.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223540234|gb|EEF41807.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 469 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -1 Query: 290 RGVRCIMERGSEVRRKVKETSEKCKNALMEGGSSWSSLGCLAEDLL 153 RGVRC+ME+ SE+R KVKE SEK + LM+GGS++SSL L ED + Sbjct: 420 RGVRCVMEQDSEIRMKVKEMSEKSRKVLMDGGSAFSSLNRLIEDAI 465 >ref|XP_003617349.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula] gi|355518684|gb|AET00308.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula] Length = 479 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = -1 Query: 290 RGVRCIMERGSEVRRKVKETSEKCKNALMEGGSSWSSLGCLAEDLLIKQI 141 RG+R ++E+ EVR+KVKE SEK + L+EGGSS+S LG L D ++ QI Sbjct: 431 RGIRNVLEKDGEVRKKVKEMSEKSRKTLLEGGSSYSHLGRLI-DFIVNQI 479