BLASTX nr result
ID: Cimicifuga21_contig00012795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012795 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN04923.1| Putative retroelement [Oryza sativa Japonica Group] 62 5e-08 gb|AAP52162.2| retrotransposon protein, putative, Ty3-gypsy subc... 62 5e-08 gb|AAM14672.1|AC097446_1 Putative polyprotein [Oryza sativa Japo... 62 5e-08 emb|CAH65865.1| OSIGBa0132I10.1 [Oryza sativa Indica Group] 61 1e-07 gb|ABB46774.2| retrotransposon protein, putative, Ty3-gypsy subc... 61 1e-07 >gb|AAN04923.1| Putative retroelement [Oryza sativa Japonica Group] Length = 1729 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +2 Query: 32 EEFGYRDRPFGIVDTNVKKTRRSAIRLVKVQWSN-DEKDVTWETEDKIMKKYPYLFA 199 E+ Y ++P I++TN +KTR IR KVQWSN E++ TWE ED++ +PYLFA Sbjct: 1662 EDLTYVEKPIRILETNERKTRNRVIRFCKVQWSNHSEEESTWEREDELKSAHPYLFA 1718 >gb|AAP52162.2| retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa Japonica Group] Length = 1730 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +2 Query: 32 EEFGYRDRPFGIVDTNVKKTRRSAIRLVKVQWSN-DEKDVTWETEDKIMKKYPYLFA 199 E+ Y ++P I++TN +KTR IR KVQWSN E++ TWE ED++ +PYLFA Sbjct: 1663 EDLTYVEKPIRILETNERKTRNRVIRFCKVQWSNHSEEESTWEREDELKSAHPYLFA 1719 >gb|AAM14672.1|AC097446_1 Putative polyprotein [Oryza sativa Japonica Group] Length = 1342 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +2 Query: 32 EEFGYRDRPFGIVDTNVKKTRRSAIRLVKVQWSN-DEKDVTWETEDKIMKKYPYLFA 199 E+ Y ++P I++TN +KTR IR KVQWSN E++ TWE ED++ +PYLFA Sbjct: 1275 EDLTYVEKPIRILETNERKTRNRVIRFCKVQWSNHSEEESTWEREDELKSAHPYLFA 1331 >emb|CAH65865.1| OSIGBa0132I10.1 [Oryza sativa Indica Group] Length = 1670 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +2 Query: 32 EEFGYRDRPFGIVDTNVKKTRRSAIRLVKVQWSN-DEKDVTWETEDKIMKKYPYLFA 199 E+ Y ++P I++TN ++TR IR KVQWSN E++ TWE ED++ +PYLFA Sbjct: 1603 EDLTYVEKPIRILETNERRTRNRVIRFCKVQWSNHSEEESTWEREDELKSAHPYLFA 1659 >gb|ABB46774.2| retrotransposon protein, putative, Ty3-gypsy subclass [Oryza sativa Japonica Group] Length = 1695 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +2 Query: 32 EEFGYRDRPFGIVDTNVKKTRRSAIRLVKVQWSN-DEKDVTWETEDKIMKKYPYLFA 199 E+ Y ++P I++TN ++TR IR KVQWSN E++ TWE ED++ +PYLFA Sbjct: 1628 EDLTYVEKPIRILETNERRTRNRVIRFCKVQWSNHSEEESTWEREDELKSAHPYLFA 1684