BLASTX nr result
ID: Cimicifuga21_contig00012719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012719 (977 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q0GZS3.1|USP_CUCME RecName: Full=UDP-sugar pyrophospharylase;... 83 1e-17 ref|XP_002864182.1| hypothetical protein ARALYDRAFT_495327 [Arab... 80 2e-17 ref|NP_568775.1| UDP-sugar pyrophosphorylase [Arabidopsis thalia... 77 3e-16 ref|NP_001237434.1| UDP-sugar pyrophosphorylase 1 [Glycine max] ... 75 2e-15 ref|XP_003526657.1| PREDICTED: UDP-sugar pyrophosphorylase 1-lik... 74 4e-15 >sp|Q0GZS3.1|USP_CUCME RecName: Full=UDP-sugar pyrophospharylase; AltName: Full=UDP-galactose/glucose pyrophosphorylase; Short=UGGPase gi|88954061|gb|ABD59006.1| UDP-galactose/glucose pyrophosphorylase [Cucumis melo] Length = 614 Score = 83.2 bits (204), Expect(2) = 1e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -2 Query: 190 VVLLESNAYFGMKPTQVKLLKQEKVACLSDKDARLTVDPHNKYRIQ 53 V LLESN+YFGMKP+QVKLLKQEKVACL D +ARL VDPHNKYRIQ Sbjct: 214 VELLESNSYFGMKPSQVKLLKQEKVACLDDNEARLAVDPHNKYRIQ 259 Score = 33.1 bits (74), Expect(2) = 1e-17 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 48 DASLKWVLFFQDTNGL 1 +A L+WVLFFQDTNGL Sbjct: 283 NAGLRWVLFFQDTNGL 298 >ref|XP_002864182.1| hypothetical protein ARALYDRAFT_495327 [Arabidopsis lyrata subsp. lyrata] gi|297310017|gb|EFH40441.1| hypothetical protein ARALYDRAFT_495327 [Arabidopsis lyrata subsp. lyrata] Length = 614 Score = 79.7 bits (195), Expect(2) = 2e-17 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -2 Query: 184 LLESNAYFGMKPTQVKLLKQEKVACLSDKDARLTVDPHNKYRIQ 53 LLESN+YFGMKPTQV LLKQEKVACL D DARL +DPHNKY IQ Sbjct: 205 LLESNSYFGMKPTQVHLLKQEKVACLDDNDARLALDPHNKYSIQ 248 Score = 36.2 bits (82), Expect(2) = 2e-17 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 48 DASLKWVLFFQDTNGL 1 DA LKWVLFFQDTNGL Sbjct: 272 DAGLKWVLFFQDTNGL 287 >ref|NP_568775.1| UDP-sugar pyrophosphorylase [Arabidopsis thaliana] gi|75168956|sp|Q9C5I1.1|USP_ARATH RecName: Full=UDP-sugar pyrophosphorylase; Short=AtUSP gi|13430648|gb|AAK25946.1|AF360236_1 unknown protein [Arabidopsis thaliana] gi|14532822|gb|AAK64093.1| unknown protein [Arabidopsis thaliana] gi|84181457|gb|ABC55066.1| nonspecific UDP-sugar pyrophosphorylase [Arabidopsis thaliana] gi|332008851|gb|AED96234.1| UDP-sugar pyrophosphorylase [Arabidopsis thaliana] Length = 614 Score = 77.4 bits (189), Expect(2) = 3e-16 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 184 LLESNAYFGMKPTQVKLLKQEKVACLSDKDARLTVDPHNKYRIQ 53 LLE N+YFGMKPTQV LLKQEKVACL D DARL +DPHNKY IQ Sbjct: 205 LLELNSYFGMKPTQVHLLKQEKVACLDDNDARLALDPHNKYSIQ 248 Score = 34.7 bits (78), Expect(2) = 3e-16 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 48 DASLKWVLFFQDTNGL 1 +A LKWVLFFQDTNGL Sbjct: 272 EAGLKWVLFFQDTNGL 287 >ref|NP_001237434.1| UDP-sugar pyrophosphorylase 1 [Glycine max] gi|122166709|sp|Q09WE7.1|USP1_SOYBN RecName: Full=UDP-sugar pyrophosphorylase 1 gi|82734755|gb|ABB89732.1| UDP-sugar pyrophosphorylase [Glycine max] Length = 600 Score = 74.7 bits (182), Expect(2) = 2e-15 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 184 LLESNAYFGMKPTQVKLLKQEKVACLSDKDARLTVDPHNKYRIQ 53 LLESN+YFGM+PTQV LLKQEKVACL D DARL ++P NKY+IQ Sbjct: 191 LLESNSYFGMQPTQVTLLKQEKVACLEDNDARLALEPQNKYKIQ 234 Score = 34.7 bits (78), Expect(2) = 2e-15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 48 DASLKWVLFFQDTNGL 1 +A LKWVLFFQDTNGL Sbjct: 258 EAGLKWVLFFQDTNGL 273 >ref|XP_003526657.1| PREDICTED: UDP-sugar pyrophosphorylase 1-like [Glycine max] Length = 600 Score = 73.6 bits (179), Expect(2) = 4e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 184 LLESNAYFGMKPTQVKLLKQEKVACLSDKDARLTVDPHNKYRIQ 53 LLESN+YFG++PTQV LLKQEKVACL D DARL ++P NKY+IQ Sbjct: 191 LLESNSYFGLQPTQVTLLKQEKVACLEDNDARLALEPQNKYKIQ 234 Score = 34.7 bits (78), Expect(2) = 4e-15 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -3 Query: 48 DASLKWVLFFQDTNGL 1 +A LKWVLFFQDTNGL Sbjct: 258 EAGLKWVLFFQDTNGL 273