BLASTX nr result
ID: Cimicifuga21_contig00012646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012646 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61806.1| hypothetical protein VITISV_014293 [Vitis vinifera] 63 3e-08 >emb|CAN61806.1| hypothetical protein VITISV_014293 [Vitis vinifera] Length = 558 Score = 62.8 bits (151), Expect = 3e-08 Identities = 36/102 (35%), Positives = 54/102 (52%) Frame = +2 Query: 2 KKQPVASNPQGVCEKLFGALSATPAFRSIRRISHHPQDPAPHPNLSPAKHPAKADPLPPP 181 ++Q V++ P G CE++F AL+ TPAFRS+RR+S+ PQ +P P +PA+ P ADP P Sbjct: 319 EQQRVSNMPTGPCERIFQALNITPAFRSMRRLSYRPQ--SPMPERAPARTPPAADP-AAP 375 Query: 182 SIQEKSHRAKLGQKTDLAPTPASGQSPGKPKEKVDAMTQMKA 307 + K+ L + P P EK + + A Sbjct: 376 KVHPKTKPIALQPPNSVVPIIFESTVHPTPNEKEKLVVNVTA 417