BLASTX nr result
ID: Cimicifuga21_contig00012628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012628 (653 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vin... 95 1e-17 ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus co... 85 1e-14 ref|XP_002308168.1| predicted protein [Populus trichocarpa] gi|2... 84 3e-14 ref|XP_003538225.1| PREDICTED: subtilisin inhibitor 1-like [Glyc... 82 7e-14 ref|XP_003598789.1| Subtilisin inhibitor [Medicago truncatula] g... 82 1e-13 >ref|XP_002269887.1| PREDICTED: subtilisin inhibitor 1 [Vitis vinifera] gi|297740333|emb|CBI30515.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 95.1 bits (235), Expect = 1e-17 Identities = 45/69 (65%), Positives = 52/69 (75%) Frame = -2 Query: 391 GASSGPKTEWPELVGSTPEAAENKIKLDMPTAQIQVVPPDHFVTMDFNTRRVRLYLDASG 212 G PKT WPE+VG T E AE KI+ DMP Q QVVPP+ FVTMDFNTRRVRL++D+ G Sbjct: 42 GVEVAPKTTWPEVVGMTVEEAERKIREDMPRVQFQVVPPNCFVTMDFNTRRVRLHVDSEG 101 Query: 211 KVARPPRRG 185 KV+R PR G Sbjct: 102 KVSRAPRIG 110 >ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus communis] gi|223527228|gb|EEF29391.1| subtilisin inhibitor 1, putative [Ricinus communis] Length = 103 Score = 85.1 bits (209), Expect = 1e-14 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -2 Query: 391 GASSGPKTEWPELVGSTPEAAENKIKLDMPTAQIQVVPPDHFVTMDFNTRRVRLYLDASG 212 G++S + WP+LVG E AE KIK DMP ++QVV P+ F+TMDF RVRL++D+SG Sbjct: 35 GSNSPARKTWPDLVGVMAEEAERKIKEDMPGVEVQVVQPNCFITMDFREGRVRLFIDSSG 94 Query: 211 KVARPPRRG 185 KVARPPR G Sbjct: 95 KVARPPRIG 103 >ref|XP_002308168.1| predicted protein [Populus trichocarpa] gi|222854144|gb|EEE91691.1| predicted protein [Populus trichocarpa] Length = 73 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/69 (59%), Positives = 49/69 (71%) Frame = -2 Query: 391 GASSGPKTEWPELVGSTPEAAENKIKLDMPTAQIQVVPPDHFVTMDFNTRRVRLYLDASG 212 G++ KT WPELVG T E AE +IK + P AQIQVV PD FVTMDF RVRL++D+ G Sbjct: 5 GSNPAAKTTWPELVGFTAEEAERRIKEEKPGAQIQVVQPDCFVTMDFRQNRVRLHVDSLG 64 Query: 211 KVARPPRRG 185 K+ R PR G Sbjct: 65 KIQRAPRIG 73 >ref|XP_003538225.1| PREDICTED: subtilisin inhibitor 1-like [Glycine max] Length = 98 Score = 82.4 bits (202), Expect = 7e-14 Identities = 41/69 (59%), Positives = 48/69 (69%) Frame = -2 Query: 391 GASSGPKTEWPELVGSTPEAAENKIKLDMPTAQIQVVPPDHFVTMDFNTRRVRLYLDASG 212 G ++ KT WPELVG T E AE KIK +M A+IQVVPP +FVT DF +RVRLY+D S Sbjct: 30 GTNNPTKTSWPELVGVTAEEAEKKIKEEMGGAEIQVVPPGYFVTADFKPKRVRLYVDESN 89 Query: 211 KVARPPRRG 185 KV R P G Sbjct: 90 KVTRAPGIG 98 >ref|XP_003598789.1| Subtilisin inhibitor [Medicago truncatula] gi|355487837|gb|AES69040.1| Subtilisin inhibitor [Medicago truncatula] Length = 98 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = -2 Query: 391 GASSGPKTEWPELVGSTPEAAENKIKLDMPTAQIQVVPPDHFVTMDFNTRRVRLYLDASG 212 G ++ KT WPELVG T E AE KIK D+ +IQVVPPD FVT DF +RVRLY+D S Sbjct: 30 GTNNPTKTSWPELVGVTAEEAERKIKEDISGVEIQVVPPDSFVTADFRFKRVRLYVDESN 89 Query: 211 KVARPP 194 KV R P Sbjct: 90 KVIRTP 95