BLASTX nr result
ID: Cimicifuga21_contig00012554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012554 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containi... 116 2e-24 ref|XP_002512769.1| pentatricopeptide repeat-containing protein,... 104 9e-21 ref|XP_003623854.1| Pentatricopeptide repeat-containing protein ... 85 5e-15 gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] 85 5e-15 ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 >ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] gi|297736133|emb|CBI24171.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 116 bits (290), Expect = 2e-24 Identities = 57/89 (64%), Positives = 69/89 (77%), Gaps = 1/89 (1%) Frame = -1 Query: 264 MLRKLPTNLPSHLSHKFMKFYLNSGDLQSARRMFDKIPEPDLPTWTILITAHTKQGHPKE 85 ML KLPT+LP HL+ KF+K Y NSGDLQ AR +FDKIP+PDLPTWTILI+A TK G E Sbjct: 1 MLSKLPTSLPPHLALKFIKVYSNSGDLQRARHLFDKIPQPDLPTWTILISALTKHGRSLE 60 Query: 84 SLALYSELRRRNVV-PDSLVLLSAAKACA 1 ++ Y++ R +N V PD L+LLS AKACA Sbjct: 61 AIQYYNDFRHKNCVEPDKLLLLSVAKACA 89 >ref|XP_002512769.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547780|gb|EEF49272.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 684 Score = 104 bits (259), Expect = 9e-21 Identities = 53/88 (60%), Positives = 63/88 (71%) Frame = -1 Query: 264 MLRKLPTNLPSHLSHKFMKFYLNSGDLQSARRMFDKIPEPDLPTWTILITAHTKQGHPKE 85 M+ KLP NL S K +K LNSGDL+ A +FDKIPEPDL TWTILI+ HT+ G PK+ Sbjct: 1 MVSKLPANLQPCQSIKLIKTCLNSGDLKRALYLFDKIPEPDLRTWTILISGHTQHGFPKK 60 Query: 84 SLALYSELRRRNVVPDSLVLLSAAKACA 1 ++ +YS L RNV PD VLLS AKACA Sbjct: 61 AIDIYSTLLSRNVRPDKFVLLSVAKACA 88 >ref|XP_003623854.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498869|gb|AES80072.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 865 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/84 (48%), Positives = 56/84 (66%) Frame = -1 Query: 252 LPTNLPSHLSHKFMKFYLNSGDLQSARRMFDKIPEPDLPTWTILITAHTKQGHPKESLAL 73 LPTN+PSHL + ++ LN GD AR++FD IP+PD T + LI+A T G E++ + Sbjct: 92 LPTNIPSHLGLRLIRVALNVGDFNRARQLFDNIPQPDPTTCSTLISALTTHGLSNEAIKI 151 Query: 72 YSELRRRNVVPDSLVLLSAAKACA 1 YS L+ R + PD V L+AAKACA Sbjct: 152 YSSLQERGIKPDMPVFLAAAKACA 175 >gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 687 Score = 85.1 bits (209), Expect = 5e-15 Identities = 41/84 (48%), Positives = 56/84 (66%) Frame = -1 Query: 252 LPTNLPSHLSHKFMKFYLNSGDLQSARRMFDKIPEPDLPTWTILITAHTKQGHPKESLAL 73 LPTN+PSHL + ++ LN GD AR++FD IP+PD T + LI+A T G E++ + Sbjct: 6 LPTNIPSHLGLRLIRVALNVGDFNRARQLFDNIPQPDPTTCSTLISALTTHGLSNEAIKI 65 Query: 72 YSELRRRNVVPDSLVLLSAAKACA 1 YS L+ R + PD V L+AAKACA Sbjct: 66 YSSLQERGIKPDMPVFLAAAKACA 89 >ref|XP_003545909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 741 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/83 (46%), Positives = 57/83 (68%) Frame = -1 Query: 252 LPTNLPSHLSHKFMKFYLNSGDLQSARRMFDKIPEPDLPTWTILITAHTKQGHPKESLAL 73 +PTN+PSHL + +K LN GD + A+++FD IP+PD T + LI+A T +G P E++ L Sbjct: 60 VPTNIPSHLGLRLLKAALNVGDFRRAQQLFDNIPQPDPTTCSTLISAFTTRGLPNEAIRL 119 Query: 72 YSELRRRNVVPDSLVLLSAAKAC 4 Y+ LR R + P + V L+ AKAC Sbjct: 120 YASLRARGIKPHNSVFLTVAKAC 142