BLASTX nr result
ID: Cimicifuga21_contig00012551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012551 (704 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118... 177 1e-42 gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] 177 1e-42 ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus comm... 174 2e-41 ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|11937... 164 1e-38 ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arab... 164 2e-38 >ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118483557|gb|ABK93676.1| unknown [Populus trichocarpa] gi|118488597|gb|ABK96111.1| unknown [Populus trichocarpa] gi|222866670|gb|EEF03801.1| glutaredoxin C4 [Populus trichocarpa] Length = 136 Score = 177 bits (450), Expect = 1e-42 Identities = 84/127 (66%), Positives = 104/127 (81%) Frame = -1 Query: 521 VSIPPVAAFLLTSFVARASSTSSAPDPESAFVKEAISSFNIVIFSKSYCPYCKMAKAVFK 342 + +P + A +T V AS T +A PE+ FVK+ ISS IVIFSKSYCPYCK AK VFK Sbjct: 5 IRLPSILATAVTLTVLAASLTWAAGSPEATFVKKTISSHQIVIFSKSYCPYCKKAKGVFK 64 Query: 341 EMNQSPHIIELDERDDGQSLQDALSEMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAK 162 E+NQ+PH++ELD+R+DG +QDA+SE+VGRRTVPQVF++GKHIGGSDDTVEAYESG LAK Sbjct: 65 ELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAK 124 Query: 161 LLGVSKD 141 LLGV+ + Sbjct: 125 LLGVASE 131 >gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] Length = 139 Score = 177 bits (450), Expect = 1e-42 Identities = 84/127 (66%), Positives = 104/127 (81%) Frame = -1 Query: 521 VSIPPVAAFLLTSFVARASSTSSAPDPESAFVKEAISSFNIVIFSKSYCPYCKMAKAVFK 342 + +P + A +T V AS T +A PE+ FVK+ ISS IVIFSKSYCPYCK AK VFK Sbjct: 5 IRLPSILATAVTLTVLAASLTWAAGSPEATFVKKTISSHQIVIFSKSYCPYCKKAKGVFK 64 Query: 341 EMNQSPHIIELDERDDGQSLQDALSEMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAK 162 E+NQ+PH++ELD+R+DG +QDA+SE+VGRRTVPQVF++GKHIGGSDDTVEAYESG LAK Sbjct: 65 ELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAK 124 Query: 161 LLGVSKD 141 LLGV+ + Sbjct: 125 LLGVASE 131 >ref|XP_002527695.1| glutaredoxin-1, grx1, putative [Ricinus communis] gi|223532926|gb|EEF34694.1| glutaredoxin-1, grx1, putative [Ricinus communis] Length = 140 Score = 174 bits (440), Expect = 2e-41 Identities = 87/125 (69%), Positives = 103/125 (82%), Gaps = 1/125 (0%) Frame = -1 Query: 506 VAAFLLTSFVARASSTSSAPDPESAFVKEAISSFNIVIFSKSYCPYCKMAKAVFKEMNQS 327 VAA +T S S+A +SAFVK+ ISS IVIFSKSYCPYCK AKAVFK++NQ Sbjct: 16 VAAATITVIATSLSWASAATGSDSAFVKKTISSHKIVIFSKSYCPYCKRAKAVFKQLNQI 75 Query: 326 PHIIELDERDDGQSLQDALSEMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS 147 PH++ELDERDDGQ++QDALS++VGRRTVPQVF++GKHIGGSDDTVEAYESG LA LLG++ Sbjct: 76 PHVVELDERDDGQNIQDALSKIVGRRTVPQVFIDGKHIGGSDDTVEAYESGELADLLGIA 135 Query: 146 -KDGL 135 KD L Sbjct: 136 GKDDL 140 >ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|119370637|sp|Q8LFQ6.2|GRXC4_ARATH RecName: Full=Glutaredoxin-C4; Short=AtGrxC4 gi|6735386|emb|CAB69043.1| glutaredoxin [Arabidopsis thaliana] gi|25082927|gb|AAN72016.1| glutaredoxin [Arabidopsis thaliana] gi|25082941|gb|AAN72019.1| glutaredoxin [Arabidopsis thaliana] gi|98960865|gb|ABF58916.1| At5g20500 [Arabidopsis thaliana] gi|332005470|gb|AED92853.1| glutaredoxin-C4 [Arabidopsis thaliana] Length = 135 Score = 164 bits (416), Expect = 1e-38 Identities = 79/115 (68%), Positives = 99/115 (86%) Frame = -1 Query: 491 LTSFVARASSTSSAPDPESAFVKEAISSFNIVIFSKSYCPYCKMAKAVFKEMNQSPHIIE 312 L +F++ SS +S+P E+ FVK+ ISS IVIFSKSYCPYCK AK+VF+E++Q P+++E Sbjct: 16 LVTFISMVSSAASSP--EADFVKKTISSHKIVIFSKSYCPYCKKAKSVFRELDQVPYVVE 73 Query: 311 LDERDDGQSLQDALSEMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS 147 LDER+DG S+Q AL E+VGRRTVPQVF+NGKH+GGSDDTV+AYESG LAKLLGVS Sbjct: 74 LDEREDGWSIQTALGEIVGRRTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVS 128 >ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] gi|297317779|gb|EFH48201.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] Length = 132 Score = 164 bits (415), Expect = 2e-38 Identities = 79/116 (68%), Positives = 101/116 (87%) Frame = -1 Query: 494 LLTSFVARASSTSSAPDPESAFVKEAISSFNIVIFSKSYCPYCKMAKAVFKEMNQSPHII 315 LL +F++ SS++S+P E+ FVK+ ISS IVIFSKSYCPYC+ AK+VF+E++Q P+++ Sbjct: 12 LLVTFISMVSSSASSP--EADFVKKTISSHKIVIFSKSYCPYCRKAKSVFRELDQVPYVV 69 Query: 314 ELDERDDGQSLQDALSEMVGRRTVPQVFVNGKHIGGSDDTVEAYESGTLAKLLGVS 147 ELDER+DG S+Q AL E+VGRRTVPQVF++GKHIGGSDDTV+AYESG LAKLLGVS Sbjct: 70 ELDEREDGWSIQTALGEIVGRRTVPQVFIDGKHIGGSDDTVDAYESGELAKLLGVS 125