BLASTX nr result
ID: Cimicifuga21_contig00012495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012495 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 95 7e-18 gb|AAA70323.1| unknown [Vicia faba] 84 9e-15 emb|CAA42947.1| unnamed protein product [Petunia x hybrida] 84 1e-14 dbj|BAG84633.1| hypothetical protein [Aegilops crassa] 75 4e-12 ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp.... 74 2e-11 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 94.7 bits (234), Expect = 7e-18 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 158 VSTAMNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKVES 21 V TAMNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKV+S Sbjct: 88 VGTAMNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKVDS 133 >gb|AAA70323.1| unknown [Vicia faba] Length = 85 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -2 Query: 146 MNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKVES 21 MNRGEPSDDLSKIRGEILSSGDP TLP TDTCTECSYGKV+S Sbjct: 1 MNRGEPSDDLSKIRGEILSSGDPLTLPWTDTCTECSYGKVDS 42 >emb|CAA42947.1| unnamed protein product [Petunia x hybrida] Length = 92 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/43 (93%), Positives = 42/43 (97%), Gaps = 1/43 (2%) Frame = -2 Query: 146 MNRGEPSDDLSKIRG-EILSSGDPFTLPRTDTCTECSYGKVES 21 MNRGEPSDDLSKIRG +ILSSGDPFTLPRTDTCTECSYGKV+S Sbjct: 1 MNRGEPSDDLSKIRGIQILSSGDPFTLPRTDTCTECSYGKVDS 43 >dbj|BAG84633.1| hypothetical protein [Aegilops crassa] Length = 113 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/42 (85%), Positives = 36/42 (85%) Frame = -2 Query: 146 MNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKVES 21 MNRGEPSDD SKIRGEILSSGDP TLP T CTECSYGKV S Sbjct: 1 MNRGEPSDDPSKIRGEILSSGDPLTLPLTYICTECSYGKVNS 42 >ref|YP_588424.1| hypothetical protein ZeamMp180 [Zea mays subsp. mays] gi|40795108|gb|AAR91152.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954228|gb|AFW86877.1| putative uncharacterized protein orf110-c [Zea mays] gi|413954267|gb|AFW86916.1| putative uncharacterized protein orf110-c [Zea mays] Length = 110 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/42 (83%), Positives = 35/42 (83%) Frame = -2 Query: 146 MNRGEPSDDLSKIRGEILSSGDPFTLPRTDTCTECSYGKVES 21 MNRGEPSDD SKIRGE LSSGDP TLP T CTECSYGKV S Sbjct: 1 MNRGEPSDDPSKIRGETLSSGDPLTLPLTYICTECSYGKVNS 42