BLASTX nr result
ID: Cimicifuga21_contig00012197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00012197 (614 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552564.1| PREDICTED: protein RIK-like [Glycine max] 57 3e-06 >ref|XP_003552564.1| PREDICTED: protein RIK-like [Glycine max] Length = 654 Score = 56.6 bits (135), Expect = 3e-06 Identities = 38/118 (32%), Positives = 52/118 (44%), Gaps = 3/118 (2%) Frame = +1 Query: 13 QRSEFVKPGPPFEDSSLRTTSSMPPPKKLAQPSFNGXXXXXXXXXXXXXSKLMSSTPLSE 192 QR + +K + +R S+MP PKKL QPS NG P Sbjct: 537 QRLQPLKTNEQSDGPVVRNISTMPAPKKLVQPSSNGMPPPLLRTMPPPPPPPKFCGPSEV 596 Query: 193 ADRGTSKPHIDSPSGSVPDTLFKLMEYGXXXXXXXEEPEKS---NSKQNTAAKPFWAL 357 + +K + + S +VPDTL KLMEYG + E+S ++ KPFWAL Sbjct: 597 KVQAKNKTLLKTKSDAVPDTLVKLMEYGEEDDDDIDSSEESLPHDAGATGVQKPFWAL 654