BLASTX nr result
ID: Cimicifuga21_contig00011627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011627 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527687.1| PREDICTED: isoflavone reductase homolog [Gly... 92 6e-17 gb|AAG22740.1|AF282850_1 allergenic isoflavone reductase-like pr... 91 1e-16 gb|AAC05116.2| isoflavone reductase homolog Bet v 6.0101 [Betula... 91 1e-16 ref|XP_002282110.1| PREDICTED: isoflavone reductase homolog P3 [... 89 3e-16 gb|ABR24114.1| eugenol synthase 2 [Clarkia breweri] 89 5e-16 >ref|XP_003527687.1| PREDICTED: isoflavone reductase homolog [Glycine max] Length = 388 Score = 91.7 bits (226), Expect = 6e-17 Identities = 47/58 (81%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +1 Query: 1 IGKTLEKIYVPEEQVLKQIEEAPVPVNVVLAIMHAVLVKGDQTNFDI-ASFGVEASEL 171 IGKTLEKIYVPEE+VLK IEEAP+P+NVVLAI H+V VKGD TNF+I SFGVEASEL Sbjct: 236 IGKTLEKIYVPEEKVLKDIEEAPLPINVVLAINHSVFVKGDHTNFEIEPSFGVEASEL 293 >gb|AAG22740.1|AF282850_1 allergenic isoflavone reductase-like protein Bet v 6.0102 [Betula pendula] Length = 308 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/58 (75%), Positives = 53/58 (91%), Gaps = 1/58 (1%) Frame = +1 Query: 1 IGKTLEKIYVPEEQVLKQIEEAPVPVNVVLAIMHAVLVKGDQTNFDI-ASFGVEASEL 171 IGKTLEKIYVPEE++LK I+E+P+P+NV+LAI H+V VKGD TNF+I ASFGVEASEL Sbjct: 234 IGKTLEKIYVPEEKLLKDIQESPIPINVILAINHSVFVKGDHTNFEIEASFGVEASEL 291 >gb|AAC05116.2| isoflavone reductase homolog Bet v 6.0101 [Betula pendula] Length = 300 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/58 (75%), Positives = 53/58 (91%), Gaps = 1/58 (1%) Frame = +1 Query: 1 IGKTLEKIYVPEEQVLKQIEEAPVPVNVVLAIMHAVLVKGDQTNFDI-ASFGVEASEL 171 IGKTLEKIYVPEE++LK I+E+P+P+NV+LAI H+V VKGD TNF+I ASFGVEASEL Sbjct: 234 IGKTLEKIYVPEEKLLKDIQESPIPINVILAINHSVFVKGDHTNFEIEASFGVEASEL 291 >ref|XP_002282110.1| PREDICTED: isoflavone reductase homolog P3 [Vitis vinifera] gi|302142513|emb|CBI19716.3| unnamed protein product [Vitis vinifera] Length = 308 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/58 (75%), Positives = 51/58 (87%), Gaps = 1/58 (1%) Frame = +1 Query: 1 IGKTLEKIYVPEEQVLKQIEEAPVPVNVVLAIMHAVLVKGDQTNFDI-ASFGVEASEL 171 IGKTLEK+YVPEEQVLK I+EAP+P+NV L+I H+V V GDQTNF+I SFGVEASEL Sbjct: 234 IGKTLEKVYVPEEQVLKDIQEAPMPINVFLSIQHSVFVNGDQTNFEIEPSFGVEASEL 291 >gb|ABR24114.1| eugenol synthase 2 [Clarkia breweri] Length = 309 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = +1 Query: 1 IGKTLEKIYVPEEQVLKQIEEAPVPVNVVLAIMHAVLVKGDQTNFDI-ASFGVEASEL 171 IGKTLEKIYVPEEQ+LK I+EAP+P+N+ L I H+V VKGD TNF+I SFGVEASEL Sbjct: 235 IGKTLEKIYVPEEQILKDIQEAPIPINIFLGINHSVFVKGDHTNFEIEPSFGVEASEL 292