BLASTX nr result
ID: Cimicifuga21_contig00011481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011481 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523882.1| PREDICTED: allene oxide synthase, chloroplas... 198 3e-49 sp|P48417.1|CP74_LINUS RecName: Full=Allene oxide synthase, chlo... 196 2e-48 gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] 189 2e-46 gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] 189 2e-46 emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] 189 2e-46 >ref|XP_003523882.1| PREDICTED: allene oxide synthase, chloroplastic-like [Glycine max] Length = 491 Score = 198 bits (504), Expect = 3e-49 Identities = 93/106 (87%), Positives = 100/106 (94%) Frame = -1 Query: 325 GDYGIPFIGPIKDRLDFFYFQGRDEFFESRAQKYKSTVFRANMPPGPFIASNPNVIVLLD 146 GDYG+PFIGPIKDRLDFFY QGRD+FF+SRAQKY STVFRANMPPGPFIASNPNVIVLLD Sbjct: 33 GDYGLPFIGPIKDRLDFFYNQGRDKFFQSRAQKYNSTVFRANMPPGPFIASNPNVIVLLD 92 Query: 145 ANSFPVLFDVSKVEKKDVFSGTYMPYLELTGGYRILSYLDPSEPNH 8 A SFPVLFDVSKVEK+DVF+GT+MP +LTGGYRILSYLDPSEP H Sbjct: 93 AKSFPVLFDVSKVEKRDVFTGTFMPSTQLTGGYRILSYLDPSEPRH 138 >sp|P48417.1|CP74_LINUS RecName: Full=Allene oxide synthase, chloroplastic; AltName: Full=Cytochrome P450 74A; AltName: Full=Hydroperoxide dehydrase; Flags: Precursor gi|404866|gb|AAA03353.1| allene oxide synthase [Linum usitatissimum] Length = 536 Score = 196 bits (498), Expect = 2e-48 Identities = 92/108 (85%), Positives = 101/108 (93%) Frame = -1 Query: 325 GDYGIPFIGPIKDRLDFFYFQGRDEFFESRAQKYKSTVFRANMPPGPFIASNPNVIVLLD 146 GDYG+P IGPI+DRLD+FY QGR+EFF+SR QKYKSTV+RANMPPGPFIASNP VIVLLD Sbjct: 77 GDYGLPGIGPIQDRLDYFYNQGREEFFKSRLQKYKSTVYRANMPPGPFIASNPRVIVLLD 136 Query: 145 ANSFPVLFDVSKVEKKDVFSGTYMPYLELTGGYRILSYLDPSEPNHTK 2 A SFPVLFD+SKVEKKD+F+GTYMP ELTGGYRILSYLDPSEPNHTK Sbjct: 137 AKSFPVLFDMSKVEKKDLFTGTYMPSTELTGGYRILSYLDPSEPNHTK 184 >gb|ABD15174.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 189 bits (481), Expect = 2e-46 Identities = 88/108 (81%), Positives = 96/108 (88%) Frame = -1 Query: 325 GDYGIPFIGPIKDRLDFFYFQGRDEFFESRAQKYKSTVFRANMPPGPFIASNPNVIVLLD 146 GDYG+P IGP KDRLD+FY QG+DEFFESR KYKST+FR NMPPGPFI+SNP VIVLLD Sbjct: 53 GDYGLPGIGPWKDRLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLD 112 Query: 145 ANSFPVLFDVSKVEKKDVFSGTYMPYLELTGGYRILSYLDPSEPNHTK 2 SFPVLFDVSKVEKKD+F+GTYMP ELTGGYR+LSYLDPSEPNH K Sbjct: 113 GKSFPVLFDVSKVEKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEK 160 >gb|ABD15173.1| allene oxide synthase 2 [Solanum tuberosum] Length = 509 Score = 189 bits (481), Expect = 2e-46 Identities = 88/108 (81%), Positives = 96/108 (88%) Frame = -1 Query: 325 GDYGIPFIGPIKDRLDFFYFQGRDEFFESRAQKYKSTVFRANMPPGPFIASNPNVIVLLD 146 GDYG+P IGP KDRLD+FY QG+DEFFESR KYKST+FR NMPPGPFI+SNP VIVLLD Sbjct: 53 GDYGLPGIGPWKDRLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLD 112 Query: 145 ANSFPVLFDVSKVEKKDVFSGTYMPYLELTGGYRILSYLDPSEPNHTK 2 SFPVLFDVSKVEKKD+F+GTYMP ELTGGYR+LSYLDPSEPNH K Sbjct: 113 GKSFPVLFDVSKVEKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEK 160 >emb|CAD29736.2| allene oxide synthase [Solanum tuberosum] Length = 509 Score = 189 bits (481), Expect = 2e-46 Identities = 88/108 (81%), Positives = 96/108 (88%) Frame = -1 Query: 325 GDYGIPFIGPIKDRLDFFYFQGRDEFFESRAQKYKSTVFRANMPPGPFIASNPNVIVLLD 146 GDYG+P IGP KDRLD+FY QG+DEFFESR KYKST+FR NMPPGPFI+SNP VIVLLD Sbjct: 53 GDYGLPGIGPWKDRLDYFYNQGKDEFFESRVVKYKSTIFRTNMPPGPFISSNPKVIVLLD 112 Query: 145 ANSFPVLFDVSKVEKKDVFSGTYMPYLELTGGYRILSYLDPSEPNHTK 2 SFPVLFDVSKVEKKD+F+GTYMP ELTGGYR+LSYLDPSEPNH K Sbjct: 113 GKSFPVLFDVSKVEKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHEK 160