BLASTX nr result
ID: Cimicifuga21_contig00011445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011445 (791 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242552.1| uncharacterized protein LOC100820390 [Glycin... 64 3e-08 ref|XP_002509898.1| conserved hypothetical protein [Ricinus comm... 63 6e-08 ref|XP_004138801.1| PREDICTED: uncharacterized protein LOC101214... 61 2e-07 gb|AFK37057.1| unknown [Lotus japonicus] 61 2e-07 emb|CAN63458.1| hypothetical protein VITISV_008242 [Vitis vinifera] 59 1e-06 >ref|NP_001242552.1| uncharacterized protein LOC100820390 [Glycine max] gi|255639953|gb|ACU20269.1| unknown [Glycine max] Length = 364 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +2 Query: 401 SGPTLYTLCTTVIDLDKQTISIFQGNPKKGEVSHVFPLS 517 +GP L+TLCT +IDLDKQT+SI +GNPKKG+VSHVF ++ Sbjct: 321 TGPLLHTLCTALIDLDKQTLSIIEGNPKKGDVSHVFSIA 359 >ref|XP_002509898.1| conserved hypothetical protein [Ricinus communis] gi|223549797|gb|EEF51285.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 63.2 bits (152), Expect = 6e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 401 SGPTLYTLCTTVIDLDKQTISIFQGNPKKGEVSHVFPLS 517 +GPTLYTLCT +IDLD QT+SI +GNP+KGE S+VF +S Sbjct: 322 TGPTLYTLCTALIDLDDQTLSIIEGNPQKGEASYVFSMS 360 >ref|XP_004138801.1| PREDICTED: uncharacterized protein LOC101214789 [Cucumis sativus] gi|449524904|ref|XP_004169461.1| PREDICTED: uncharacterized LOC101214789 [Cucumis sativus] Length = 361 Score = 61.2 bits (147), Expect = 2e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 401 SGPTLYTLCTTVIDLDKQTISIFQGNPKKGEVSHVFPL 514 +GP LYTLCT +IDLD+QT+SI QGNPKK +SHVF + Sbjct: 316 TGPMLYTLCTALIDLDEQTLSIIQGNPKKNVISHVFSM 353 >gb|AFK37057.1| unknown [Lotus japonicus] Length = 369 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 401 SGPTLYTLCTTVIDLDKQTISIFQGNPKKGEVSHVFPLS 517 +GP L+TLCT ++DLD+QT+SI GNPK G+VSHVF +S Sbjct: 326 TGPLLHTLCTAIVDLDEQTLSIIAGNPKNGDVSHVFSIS 364 >emb|CAN63458.1| hypothetical protein VITISV_008242 [Vitis vinifera] Length = 370 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 398 FSGPTLYTLCTTVIDLDKQTISIFQGNPKKGEVSH 502 FSG TLYTLCT V+DLDKQ +S+ +GN KKGE+SH Sbjct: 297 FSGSTLYTLCTEVLDLDKQALSVIEGNLKKGEISH 331