BLASTX nr result
ID: Cimicifuga21_contig00011312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011312 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621474.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma... 84 9e-15 ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 82 5e-14 ref|XP_003621465.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma... 80 2e-13 ref|XP_003551761.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 79 3e-13 ref|XP_003621467.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-ma... 78 7e-13 >ref|XP_003621474.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] gi|355496489|gb|AES77692.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] Length = 458 Score = 84.3 bits (207), Expect = 9e-15 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -1 Query: 170 PVQRLFFYEFPHPKTHFINTFLPNIKQSLSITLQHFYPLAGNLFWPQDAFKPEIVY 3 PVQR+FFYEFPH + F NT LP +KQSLS+TL HFYPL G+L WP D+ KP I + Sbjct: 38 PVQRIFFYEFPHQTSLFFNTLLPKLKQSLSLTLSHFYPLLGHLIWPNDSHKPIIKF 93 >ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransferase [Vitis vinifera] gi|296081274|emb|CBI18018.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 82.0 bits (201), Expect = 5e-14 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = -1 Query: 167 VQRLFFYEFPHPKTHFINTFLPNIKQSLSITLQHFYPLAGNLFWPQDAFKPEIVY 3 VQ +FFYE+PHPKTHFI T +P +K SLS+TL+HFYP AGNL +P + KP+I Y Sbjct: 43 VQSVFFYEYPHPKTHFIETTIPALKHSLSLTLKHFYPFAGNLLFPPNLGKPQIHY 97 >ref|XP_003621465.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] gi|355496480|gb|AES77683.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] Length = 461 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -1 Query: 170 PVQRLFFYEFPHPKTHFINTFLPNIKQSLSITLQHFYPLAGNLFWPQDAFKPEIVY 3 PVQR+FFYEFPH + F T LP +K+SLSI L HFYPL G+L WP D+ KP I + Sbjct: 40 PVQRIFFYEFPHQTSFFFKTLLPKLKKSLSIALSHFYPLLGHLIWPHDSHKPIIKF 95 >ref|XP_003551761.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Glycine max] Length = 450 Score = 79.3 bits (194), Expect = 3e-13 Identities = 35/56 (62%), Positives = 41/56 (73%) Frame = -1 Query: 170 PVQRLFFYEFPHPKTHFINTFLPNIKQSLSITLQHFYPLAGNLFWPQDAFKPEIVY 3 PVQR+FFYEFPHP F +T LP +K SLS+ L HFYPLAG+L WP + KP I Y Sbjct: 39 PVQRIFFYEFPHPTHLFFDTLLPKLKHSLSLALAHFYPLAGHLIWPLHSAKPIINY 94 >ref|XP_003621467.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] gi|355496482|gb|AES77685.1| Malonyl-CoA isoflavone 7-O-glucoside-6'-O-malonyltransferase [Medicago truncatula] Length = 458 Score = 78.2 bits (191), Expect = 7e-13 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -1 Query: 170 PVQRLFFYEFPHPKTHFINTFLPNIKQSLSITLQHFYPLAGNLFWPQDAFKPEIVY 3 PVQR+FFYEFPH + F NT LP +K+SLSI L +FYPL G+L WP D+ KP I + Sbjct: 38 PVQRIFFYEFPHQTSLFYNTLLPKLKKSLSIALSYFYPLLGHLTWPNDSHKPIIKF 93