BLASTX nr result
ID: Cimicifuga21_contig00011276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011276 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_565328.1| nodulin MtN21 /EamA-like transporter protein [A... 55 8e-06 gb|AAM63171.1| unknown [Arabidopsis thaliana] 55 8e-06 >ref|NP_565328.1| nodulin MtN21 /EamA-like transporter protein [Arabidopsis thaliana] gi|20198220|gb|AAM15467.1| Expressed protein [Arabidopsis thaliana] gi|109134115|gb|ABG25056.1| At2g05755 [Arabidopsis thaliana] gi|110738794|dbj|BAF01320.1| hypothetical protein [Arabidopsis thaliana] gi|330250873|gb|AEC05967.1| nodulin MtN21 /EamA-like transporter protein [Arabidopsis thaliana] Length = 401 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -1 Query: 386 NYPVYDVCVGLFSSITGGISYCLIRSGAKASDQPV*DH*WLGLVARMVSLTDIFIF 219 N+ +Y +GLFSSITGGI+YCLI++ AKAS+QPV GLVA + +F F Sbjct: 249 NHHIYAFLLGLFSSITGGITYCLIKAAAKASEQPVITVLSFGLVACPATAICMFSF 304 >gb|AAM63171.1| unknown [Arabidopsis thaliana] Length = 401 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -1 Query: 386 NYPVYDVCVGLFSSITGGISYCLIRSGAKASDQPV*DH*WLGLVARMVSLTDIFIF 219 N+ +Y +GLFSSITGGI+YCLI++ AKAS+QPV GLVA + +F F Sbjct: 249 NHHIYAFLLGLFSSITGGITYCLIKAAAKASEQPVITVLSFGLVACPATAICMFSF 304