BLASTX nr result
ID: Cimicifuga21_contig00011019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00011019 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276167.1| PREDICTED: uncharacterized protein LOC100244... 59 5e-07 ref|XP_002534177.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002276167.1| PREDICTED: uncharacterized protein LOC100244272 [Vitis vinifera] gi|297740278|emb|CBI30460.3| unnamed protein product [Vitis vinifera] Length = 278 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = +3 Query: 111 GKSTPHSQLSRKYIRRVCQVKSEDCDGNLSGDGTILDEQTLEMHLQKAVEEENYA 275 G +T Q S + R CQVKSED +G LSG+ +LDEQ+L LQ A+EEENYA Sbjct: 85 GTATLLGQTSNLFSVRPCQVKSEDSEGTLSGESILLDEQSLMRDLQIAIEEENYA 139 >ref|XP_002534177.1| conserved hypothetical protein [Ricinus communis] gi|223525737|gb|EEF28201.1| conserved hypothetical protein [Ricinus communis] Length = 190 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = +3 Query: 123 PHSQLSRKYIRRVCQVKSEDCDGNLSGDGTILDEQTLEMHLQKAVEEENYA 275 P ++ SR R CQVKSED + LSG+ ILDEQ L LQ A+EEENYA Sbjct: 1 PFAKASRLLSIRACQVKSEDSEEMLSGESIILDEQALTRDLQIAIEEENYA 51