BLASTX nr result
ID: Cimicifuga21_contig00010973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cimicifuga21_contig00010973 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169261.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 69 3e-10 ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220... 69 3e-10 ref|XP_002271658.2| PREDICTED: uncharacterized protein LOC100262... 69 3e-10 emb|CBI31905.3| unnamed protein product [Vitis vinifera] 69 3e-10 emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera] 69 3e-10 >ref|XP_004169261.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] Length = 136 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 346 KLLNLNIFIPLALQALITCGKTPPPGFVCPPL 251 KLLNLNIFIPLALQALITCGK PPPGFVCPPL Sbjct: 105 KLLNLNIFIPLALQALITCGKNPPPGFVCPPL 136 >ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220939 [Cucumis sativus] Length = 253 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 346 KLLNLNIFIPLALQALITCGKTPPPGFVCPPL 251 KLLNLNIFIPLALQALITCGK PPPGFVCPPL Sbjct: 222 KLLNLNIFIPLALQALITCGKNPPPGFVCPPL 253 >ref|XP_002271658.2| PREDICTED: uncharacterized protein LOC100262648 [Vitis vinifera] Length = 236 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 346 KLLNLNIFIPLALQALITCGKTPPPGFVCPPL 251 KLLNLNIFIP+AL+ALITCGKTPPPGFVCPPL Sbjct: 205 KLLNLNIFIPIALEALITCGKTPPPGFVCPPL 236 >emb|CBI31905.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 346 KLLNLNIFIPLALQALITCGKTPPPGFVCPPL 251 KLLNLNIFIP+AL+ALITCGKTPPPGFVCPPL Sbjct: 125 KLLNLNIFIPIALEALITCGKTPPPGFVCPPL 156 >emb|CAN80711.1| hypothetical protein VITISV_033378 [Vitis vinifera] Length = 261 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 346 KLLNLNIFIPLALQALITCGKTPPPGFVCPPL 251 KLLNLNIFIP+AL+ALITCGKTPPPGFVCPPL Sbjct: 205 KLLNLNIFIPIALEALITCGKTPPPGFVCPPL 236